Align FAA hydrolase family protein (characterized, see rationale)
to candidate AZOBR_RS26375 AZOBR_RS26375 hypothetical protein
Query= uniprot:A0A2E7P912 (281 letters) >FitnessBrowser__azobra:AZOBR_RS26375 Length = 293 Score = 157 bits (397), Expect = 3e-43 Identities = 108/293 (36%), Positives = 152/293 (51%), Gaps = 28/293 (9%) Query: 1 MKLLRYGPVGQEKPGVLDQSGKIRDLSAYIKDVNGAVLDDASLDKIRKLDLESLPAVEGS 60 M+ + + G+ K GV+D + I+ V G + D LD IR+ D GS Sbjct: 1 MRFVTFQHDGRRKLGVIDPDTQ---RVWPIESVLGEPVRDM-LDLIRRYDAAKGEMTLGS 56 Query: 61 P-------RIGACVGNIGKFI-CIGLNYADHAAE------------SNLPIPAEPVVFNK 100 R+ A + + I C+G NY DHA E + IP P+ F K Sbjct: 57 VGIPLTDVRVDAPIPRPDRNIFCVGKNYHDHAHEFTRSGFDAGSKVATDAIPEAPIFFTK 116 Query: 101 WTSAVVGPNDDVKIPRG-SKKTDWEVELGVVIGKGGSYIDEKDAMSHVAGYCVVNDVSER 159 V+ D ++ P G S D+E ELGVVIGKGG I + +A HV GY ++ND++ R Sbjct: 117 PPETVIANGDPIRYPHGVSDSLDYEAELGVVIGKGGRGITKAEAYDHVFGYVIINDMTAR 176 Query: 160 EYQIERGGTWDKGKGCDTFGPIGPWLVTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFG 219 ++Q R W GK DTF P+GPWL T DEV D L + V+ + QN NT +IF Sbjct: 177 DWQ-SRHKQWFLGKSFDTFCPMGPWLATTDEV-DAANLALRCWVNDELRQNANTRDLIFD 234 Query: 220 VAHIVSYLSRFMSLQPGDVISTGTPPGVGMGVKPEAVYLRAGQTMRLGIDGLG 272 + ++ LS ++L PGD+I+TGTP GVG+G P +L+ G + + IDGLG Sbjct: 235 IPTMIETLSAGITLYPGDIIATGTPAGVGIGFNPPK-FLKPGDRVTIEIDGLG 286 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 293 Length adjustment: 26 Effective length of query: 255 Effective length of database: 267 Effective search space: 68085 Effective search space used: 68085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory