Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate AZOBR_RS17415 AZOBR_RS17415 ferredoxin
Query= metacyc::MONOMER-18073 (163 letters) >FitnessBrowser__azobra:AZOBR_RS17415 Length = 227 Score = 141 bits (356), Expect = 6e-39 Identities = 73/165 (44%), Positives = 95/165 (57%), Gaps = 15/165 (9%) Query: 11 KIKVKVNGVLYERYVSPRILLVDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTL 70 K+ VNG + + R L+D LRE L LTGTK GCD CGACTV+++G+ + SC Sbjct: 61 KVTFTVNGQRRDLELDTRTTLLDALREHLHLTGTKKGCDHGQCGACTVIVDGQRINSCLS 120 Query: 71 FAVQADGAEITTIEGLSVDSKLHPIQEAFKENFALQCGFCTPGMIMQAYFLLKE------ 124 AV +G +TTIEGL + KLHP+Q AF E+ QCG+CTPG I A +L E Sbjct: 121 LAVMHEGGSVTTIEGLGLPGKLHPMQAAFVEHDGYQCGYCTPGQICSAVAMLDEIKAGVP 180 Query: 125 ---------NPNPSEEEVRDGLHGNICRCTGYQNIVKAVLDASRR 160 P + +E R+ + GNICRC Y NIV A+ D +RR Sbjct: 181 SHVTADLNAAPQATVDEYRERMSGNICRCGAYSNIVDAISDVARR 225 Lambda K H 0.322 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 227 Length adjustment: 20 Effective length of query: 143 Effective length of database: 207 Effective search space: 29601 Effective search space used: 29601 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory