Align Probable 2-keto-3-deoxyxylonate dehydratase; KDXD; EC 4.2.1.141 (characterized)
to candidate AZOBR_RS15905 AZOBR_RS15905 2-hydroxyhepta-2 4-diene-1 7-dioate isomerase
Query= SwissProt::D4GP28 (289 letters) >FitnessBrowser__azobra:AZOBR_RS15905 Length = 283 Score = 78.6 bits (192), Expect = 2e-19 Identities = 71/215 (33%), Positives = 105/215 (48%), Gaps = 32/215 (14%) Query: 90 ISEQAREEESSMPDMYFDVYDADRPEVFFKATPSRTVEPGDAIGV-RGDSEWDVPEPELG 148 ++ +A ES +P+ P +F KAT S P D + + RG ++ D E ELG Sbjct: 78 LNYRAHAAESGLPE-------PAEPVLFMKATTS-ICGPNDPVQMPRGATKLDW-EVELG 128 Query: 149 IVLRR-----------GEIVGYTVGNDVSSRSIEGENPLYLPQAKVYDRCCSIGPCVVTP 197 IV+ R I GY V NDVS R+ + E+ + K D C IGP +VT Sbjct: 129 IVIGRTARYVEQADAFDHIAGYCVLNDVSERAFQTESTGQWVKGKSADSFCPIGPWMVTR 188 Query: 198 EDVEDPHELEMSMTIERDGEVIYDDATNTSEMVRSCDELVSYFTRHNTVPELAVILTGT- 256 ++V DP L + +E DG+ + D + T++M+ E+VSY +R T+ VI TGT Sbjct: 189 DEVPDPQALR--LWLEVDGQPMQD--STTADMIFGVAEIVSYISRFMTLLPGDVIATGTP 244 Query: 257 -----SLVPEQPFDLQEGDHVDITIEGIGTLSNSV 286 P P+ LQ G + + +EG+G SV Sbjct: 245 QGVALGRGPNHPW-LQPGQTMRLGVEGLGEQRQSV 278 Lambda K H 0.314 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 283 Length adjustment: 26 Effective length of query: 263 Effective length of database: 257 Effective search space: 67591 Effective search space used: 67591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory