Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate AZOBR_RS13230 AZOBR_RS13230 alcohol dehydrogenase
Query= CharProtDB::CH_000596 (353 letters) >FitnessBrowser__azobra:AZOBR_RS13230 Length = 340 Score = 144 bits (362), Expect = 4e-39 Identities = 98/273 (35%), Positives = 144/273 (52%), Gaps = 13/273 (4%) Query: 7 QNMKAAVMHNTR-EIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVE-- 63 + MKAAV+ + + IE +PVP++ ++L+K+ A G+C +DLH G++ V+ Sbjct: 3 KTMKAAVVRQFKMPLSIEEVPVPEVGPGQILVKIEASGVCHTDLH----AADGDWPVKPN 58 Query: 64 KPFILGHECAGEIAAVGSSVDQFKVGDRVAVE-PGVTCGRCEACKEGRYNLCPDVQFLAT 122 PFI GHE G +AAVG+ V K GDRV V CG C C G LC D+Q Sbjct: 59 PPFIPGHEGVGTVAAVGTGVTAVKEGDRVGVPWLHTACGHCRQCLAGWETLC-DLQQNTG 117 Query: 123 PPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAAR-TKLQPGSTIAIMGM 181 V+G F +Y ++V +PD L +E AA I V ++ + T +PG T+ I G+ Sbjct: 118 YSVNGGFAEYTLADPNYVGHLPDRLDWEMAAPILCAGVTVYKGLKETDTKPGDTVVISGI 177 Query: 182 GPVGLMAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDRG 241 G +G +AV AKA G +I D+ +L A+ MGA IN + D + E+K + G Sbjct: 178 GGLGHIAVQYAKAMGL-DVIAVDISDEKLALARAMGADAAINAKTTDPVAEVKALCG--G 234 Query: 242 VDVAWETAGNPAALQSALASVRRGGKLAIVGLP 274 TA + A AL + + G +A+VGLP Sbjct: 235 AQGVLVTAVSRHAFNQALGMLAKRGTMALVGLP 267 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 340 Length adjustment: 29 Effective length of query: 324 Effective length of database: 311 Effective search space: 100764 Effective search space used: 100764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory