Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate AZOBR_RS31200 AZOBR_RS31200 sugar ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >FitnessBrowser__azobra:AZOBR_RS31200 Length = 325 Score = 132 bits (331), Expect = 1e-35 Identities = 100/308 (32%), Positives = 154/308 (50%), Gaps = 15/308 (4%) Query: 11 RELGPLVALVSLAVFTAILNPRFLTAFNLQALGRQI---AIFGLLAIGETFVIISGGGAI 67 R L LV L V + +F +L+ +G + A G+ A+G TFVI+SGG I Sbjct: 4 RFLPLLVTSAVLVVGFLLCAAQFPNFASLRVVGNLLTDNAFLGITAVGMTFVILSGG--I 61 Query: 68 DLSPGSMVALTGVMVAWLMTHGVPVWISVILILLFSIGA-GAWHGLFVTKLRVPAFIITL 126 DLS G+++ T V++A L+ G +S + L G GA G + ++P FI+TL Sbjct: 62 DLSVGAVIGFTTVLLAVLIEQGGWHPVSAFAVALAVAGGFGAAMGAVIHVFQMPPFIVTL 121 Query: 127 GTLTIARGMAAVI-TKGWPI-----IGLPSSFLKIGQGEFLKIPIPVWILLAVALVADFF 180 + +ARG+ V+ T PI L L+ G K+ +P ++L V A Sbjct: 122 AGMFVARGLGFVLSTDSIPINHPLYAELGDLALRFDGGG--KLTLPALLMLGVVAAAVVC 179 Query: 181 LRKTVYGKHLRASGGNEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGV 240 T +G +L A GGN +A GV V R + + +SG LAG+ GI+ + G Sbjct: 180 AHWTRFGANLYALGGNRQSAELMGVPVGRTTVAVYALSGLLAGLAGIVFSLYTGAGYSLA 239 Query: 241 GSMYELYAIASTVIGGTSLTGGEGSVLGAIVGASIISLLWNALVL-LNVSTYWHNVVIGI 299 + EL I + VIGGT LTGG G V+G +G I L+ + ++S++W + IG+ Sbjct: 240 ATGVELDTITAVVIGGTQLTGGYGYVIGTFIGVLIQGLIQTYITFDGSLSSWWTKIAIGV 299 Query: 300 VIVVAVTL 307 ++ V + L Sbjct: 300 LLFVFILL 307 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 325 Length adjustment: 28 Effective length of query: 289 Effective length of database: 297 Effective search space: 85833 Effective search space used: 85833 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory