GapMind for catabolism of small carbon sources

 

Protein GFF3101 in Pseudomonas stutzeri RCH2

Annotation: Psest_3160 ABC-type polar amino acid transport system, ATPase component

Length: 255 amino acids

Source: psRCH2 in FitnessBrowser

Candidate for 27 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism Pf6N2E2_5405 hi ABC transporter for D-Alanine, ATPase component (characterized) 87% 100% 449.5 uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ 77% 407.9
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 76% 96% 399.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 76% 96% 399.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 76% 96% 399.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-histidine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 76% 96% 399.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 76% 96% 399.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 76% 96% 399.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 75% 94% 386 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 75% 94% 386 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-glutamate catabolism gltL med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 75% 94% 386 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 65% 93% 328.9 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 64% 95% 303.9 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 64% 95% 303.9 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 59% 100% 285 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 59% 100% 285 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 57% 99% 275.8 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 57% 99% 275.8 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 54% 100% 253.8 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-histidine catabolism bgtA med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 53% 97% 252.7 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 53% 97% 244.6 ABC transporter for D-Alanine, ATPase component 87% 449.5
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-Glucosamine, putative ATPase component (characterized) 49% 97% 239.6 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-histidine catabolism hisP med Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 49% 97% 237.3 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 50% 97% 236.1 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-citrulline catabolism AO353_03040 med ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 46% 98% 231.9 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-citrulline catabolism PS417_17605 med ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 47% 95% 228 ABC transporter for D-Alanine, ATPase component 87% 449.5
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 73% 168.7 ABC transporter for D-Alanine, ATPase component 87% 449.5
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 33% 87% 115.5 ABC transporter for D-Alanine, ATPase component 87% 449.5

Sequence Analysis Tools

View GFF3101 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MSDSNAQVEQASGPVIQMQGVHKWFGQFHVLKDINLSVRQGERIVLCGPSGSGKSTTIRC
LNRLEEHQQGRIVINGVELTSDLKQIEAIRSEVGMVFQHFNLFPHLTVLQNCTLAPMWVR
KLPRRQAEEIAMHYLERVRIPEQANKFPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSA
LDPEMVKEVLDTMVSLAESGMTMLCVTHEMGFARTVADRVIFMDKGEIVEQAEPEMFFTN
PVNDRTKLFLSQILH

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory