GapMind for catabolism of small carbon sources

 

Protein GFF3591 in Pseudomonas stutzeri RCH2

Annotation: Psest_3658 spermidine/putrescine ABC transporter ATP-binding subunit

Length: 369 amino acids

Source: psRCH2 in FitnessBrowser

Candidate for 54 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med PotG aka B0855, component of Putrescine porter (characterized) 46% 85% 271.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 41% 89% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 47% 75% 250.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 45% 77% 250 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 42% 94% 247.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 42% 94% 247.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 42% 92% 245.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 42% 87% 241.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 46% 78% 241.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 45% 78% 240.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 89% 240.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 91% 238 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 91% 238 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 41% 91% 238 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 44% 77% 236.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-sorbitol, ATPase component (characterized) 43% 81% 235.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 47% 72% 234.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 41% 96% 234.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 43% 80% 233.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 44% 77% 232.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 44% 85% 231.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 82% 228.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 82% 228.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism malK med MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 41% 80% 226.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 42% 78% 225.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 83% 224.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 83% 224.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 83% 224.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 83% 224.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 83% 224.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 83% 224.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 42% 83% 223 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 43% 82% 218.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 41% 74% 214.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 40% 93% 238.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 37% 97% 227.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 50% 58% 222.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 80% 208 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 39% 76% 188.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 39% 80% 164.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 89% 163.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 48% 319.7

Sequence Analysis Tools

View GFF3591 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MVESTANDILVSFRGIQKSYDGESLIVRDLNLDIRRGEFLTLLGPSGSGKTTSLMMLAGF
ETPTAGEILLDGRAINNVPPHKRDMGMVFQNYALFPHMTVSENLAFPLSVRGMAKPDIKE
RVKRALAMVQLEGFRNRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREQM
QMEIKHLHERLGVTVVYVTHDQGEALTMSDRVAVFHQGQIQQIEDPRTLYEKPVNTFVAN
FLGENNRLPAHLLDRRGDSCTVKLGRGETVEALAVNVGAAGTPVSLSIRPERVLLNGASA
NCPNRFTGRVAEFIYLGDHIRIRLEVCGVSDFFVKQPIAEFDSALRVGDVVPIGWHVEHV
RALDPLQAA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory