Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate GFF773 Psest_0787 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
Query= reanno::SB2B:6938088 (339 letters) >FitnessBrowser__psRCH2:GFF773 Length = 332 Score = 316 bits (810), Expect = 5e-91 Identities = 169/324 (52%), Positives = 216/324 (66%), Gaps = 3/324 (0%) Query: 18 ASLLATVLGFS---FGAVAEPVEIKFSHVVAENTPKGQMALKFKELVESRLPGEYKVSVF 74 A+L+A + FS A AEP+ IKF+HVVA++TPKG+ AL K+LVE R+ G+ KV V+ Sbjct: 7 AALVAALYWFSAPAMAAEAEPIVIKFAHVVADDTPKGKGALLLKQLVEQRMAGKVKVEVY 66 Query: 75 PNSQLFGDNNELAALLLNDVQLVAPSLSKFERYTKKLQVFDLPFLFEDMDAVDRFQQSEA 134 PNS L GD E+ AL N VQL+APS+SKF YTKKLQVFDLPFLF+D +A+ RFQ+ EA Sbjct: 67 PNSTLVGDAEEMQALFDNKVQLLAPSMSKFAPYTKKLQVFDLPFLFDDAEALQRFQKREA 126 Query: 135 GQQLLNSMSRKGLVGLGYLHNGMKQFSANNALSLPGDAAGKKFRIMPSDVIAAQFEAVGA 194 +QLL SM+ G+ GL Y +NG+KQ SA L P DA G FRI PS V+ AQF AVGA Sbjct: 127 ARQLLRSMADHGVYGLAYWNNGLKQLSATTPLRKPSDANGLAFRIQPSPVLEAQFAAVGA 186 Query: 195 IPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQTHITESNHGVLDYMLVTSETFW 254 V PF++V+ L+ + G EN WSNI S+ + VQ +ITESNHGVLDYML+T+ FW Sbjct: 187 KSVVLPFAKVYESLKGGVVQGAENPWSNILSQNMHSVQPYITESNHGVLDYMLITNNDFW 246 Query: 255 KSLPKDKREIIKQSMDEAVALGNKLALEKANEDRQLILDSKRVELVTLTPEQRQAWVNAM 314 S+P R ++ + E N+ A DR+ IL S +L+TLTPE+RQAW M Sbjct: 247 LSMPFAVRSELEGIILEVTQAVNREAAAVNRRDRERILASGSSQLITLTPEERQAWREQM 306 Query: 315 RPVWSQFEDKIGKDLIEAAESANK 338 PVW +E IG DLI AA + N+ Sbjct: 307 LPVWKTYEADIGADLIRAAMTVNR 330 Lambda K H 0.316 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 332 Length adjustment: 28 Effective length of query: 311 Effective length of database: 304 Effective search space: 94544 Effective search space used: 94544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory