Align BadH (characterized)
to candidate GFF1114 Psest_1147 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__psRCH2:GFF1114 Length = 252 Score = 143 bits (360), Expect = 4e-39 Identities = 92/260 (35%), Positives = 142/260 (54%), Gaps = 18/260 (6%) Query: 3 RLQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRC 62 +LQ+K ++TGGG G+G A A +GA++A+ DLN + ++ A + AGG A A C Sbjct: 2 QLQDKVIIVTGGGQGLGRAMGEYLAGKGARLALVDLNQERLDEAVAACKAAGGDARAYLC 61 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGE--------WERLIAIN 114 ++A+ V +A G + LVNNAG K + GE W+ +I +N Sbjct: 62 NVANEEQVTDMVARVAEDFGGLHGLVNNAGILRDGLLLKVKDGEISKMSLAQWQAVIDVN 121 Query: 115 LTGALHMHHAVLPGMVE-RRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREH 173 LTG V MVE + G I+NI+S +R G+ G+ Y+A K G+ + + A+E Sbjct: 122 LTGVFLCTREVAAKMVELKSEGAIINISS-ISRAGNMGQTNYSAAKAGVASATVVWAKEL 180 Query: 174 ARHGITVNVVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFG 233 AR+GI V V PG +T ++A + PE L E T IPL R+GKP ++A ++A+ Sbjct: 181 ARYGIRVAGVAPGFIETEMVASM-----KPEAL-EKMTSGIPLKRMGKPAEIAHSVAYIF 234 Query: 234 SDDAGFITGQVLSVSGGLTM 253 +D + TG++L + GGL + Sbjct: 235 END--YYTGRILELDGGLRL 252 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory