Align 4-hydroxybenzoate--CoA/benzoate--CoA ligase; 4-hydroxybenzoyl-CoA synthetase; EC 6.2.1.25; EC 6.2.1.27 (characterized)
to candidate GFF2177 Psest_2220 Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
Query= SwissProt::Q53005 (539 letters) >FitnessBrowser__psRCH2:GFF2177 Length = 585 Score = 195 bits (495), Expect = 5e-54 Identities = 167/555 (30%), Positives = 251/555 (45%), Gaps = 38/555 (6%) Query: 1 MPLRDYNAAVDFVDRNVAEGRGGKIA--FID---PQRSLSYGELRDAVARVGPMLARLGV 55 +P N A + VDR+ A R G A F++ +R LSY +L+ R +LA+LGV Sbjct: 41 LPGGGLNLAHEAVDRHAAGPRAGYCALRFLERNGSRRELSYLQLKRQTNRFANVLAQLGV 100 Query: 56 EQENRIALVLKDTVDFPILFWGAIRAGIV---------PVLLNTRLTADQYRYLLEDSRS 106 + R+ ++ V+ + G ++ G V P L TRL LL S Sbjct: 101 ARGERLFVLCNRGVELYLGVLGGLKNGCVVSPLFAAFGPEPLETRLRLGDCSVLLT---S 157 Query: 107 RVVFASSEFLPVIEEAAADLPHLRTIIAVGDAPAPT-----LQLANLLATEQEGGAPAAT 161 +++ + LP L+ ++ ++ T L L +LLA E A T Sbjct: 158 EMLYRKK-----VARLRDRLPLLKHVLLYDESGGHTSIDGTLDLHDLLAAAGEEFKIAPT 212 Query: 162 CADDIAYWQYSSGTTGMPKGVMHVHSSPRVMAENAGRRIGYREDDVVFSAAKLFFAYGLG 221 AD + ++SGTTG PKG +HVH + + DD+ + +A + G Sbjct: 213 TADSPSLLHFTSGTTGTPKGALHVHGAALTHYVTGRYALDLHPDDIYWCSADPGWVTGTS 272 Query: 222 NAMFCPMGIGATSVLYPERPTADSVFDTLRLHQPTLLFAVPT-LYAAMLADPRSRTETLP 280 + P+ +G TSV+ A+ + L + ++ + PT + M A P Sbjct: 273 YGILAPLLLGVTSVVDCGEFDAERWYGILEKERISVWYTAPTAIRMLMKAGPELARRHFH 332 Query: 281 DRLRLCVSAGEPLPAQVGLNWRNRFGHDIVNGVGSTEMGHLFLTNLPHA-VEYGTSGVPV 339 +LR S GEPL + + G I + TE G + + N+P ++ G+ G P+ Sbjct: 333 PQLRFVASVGEPLNPEAVWWGKEVLGLPIHDNWWQTETGGIMIANIPAMPIKPGSMGKPL 392 Query: 340 DGYRLRLVGDRGQD-----VADDEIGELLVSGG--SSAAGYWNQRDKTRTTFVGEWTRTG 392 G +V G+D + DDEIGEL + Y Q ++ R F G+W +G Sbjct: 393 PGVEAAIVR-HGEDGNLTFLGDDEIGELALKQPWPGMFRTYLGQEERYRRCFAGDWYLSG 451 Query: 393 DKYHRRADGVYTYCGRTDDIFKVSGIWVSPFEIEQALMSHAKVLEAAVIPAEDTDGLIKP 452 D R ADG Y + GR+DD+ K +G + PFE+E ALM H+ V EAAVI D Sbjct: 452 DLARRDADGYYWFIGRSDDVIKSAGHLIGPFEVESALMEHSAVAEAAVIGKPDPLLGETV 511 Query: 453 KAFIVLASRGDIDPGALFDELKEHVKSAIGPWKYPRWIQIMDDLPKTSSGKLQRYLLREM 512 KAF+ L RG AL DEL H + +G P+ ++ + LP+T SGKL R LL+ Sbjct: 512 KAFVSL-KRGREASEALHDELIGHARKRLGAAVAPKELEFLASLPRTRSGKLMRRLLKAR 570 Query: 513 TLGGIEATESAPSEP 527 LG E S P Sbjct: 571 ELGLPEGDISTLENP 585 Lambda K H 0.320 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 831 Number of extensions: 48 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 539 Length of database: 585 Length adjustment: 36 Effective length of query: 503 Effective length of database: 549 Effective search space: 276147 Effective search space used: 276147 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory