Align 3-oxoadipate enol-lactonase (EC 3.1.1.24); 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) (characterized)
to candidate GFF3011 Psest_3069 3-oxoadipate enol-lactonase
Query= BRENDA::Q0SH24 (400 letters) >FitnessBrowser__psRCH2:GFF3011 Length = 262 Score = 189 bits (480), Expect = 8e-53 Identities = 103/238 (43%), Positives = 136/238 (57%), Gaps = 4/238 (1%) Query: 15 GAADAPVVVLLGSLGSNRSMWDPQIAALSYECRVVAVDQRGHGESPAPDGPYSVRDLSED 74 GA +APV+VL SLG++ MWD QIAA + RV+ D RGHG S GPYS+ L +D Sbjct: 17 GAENAPVLVLSNSLGTDLQMWDDQIAAFAEHFRVLRYDTRGHGGSGVTPGPYSIEQLGQD 76 Query: 75 VLALLDSLGVDAAHFVGLSMGGAIAQWLGAHAPRRVLSLSLLCTAAKFGEPQAW---IER 131 VL +LD+ G++ F GLSMGG I QWLG HA R+ L L T AK G + W I+ Sbjct: 77 VLGMLDAFGIERFAFCGLSMGGLIGQWLGIHAGERLQRLVLCNTGAKIGTDEVWNTRIDS 136 Query: 132 AAASRTDGPESLADAVVARWFSEGLAKRDPEFVRHYREMIASTSPEGYAACCDALADWDF 191 A R + DA +ARWF+ A+ +P +MIASTSP+GYAA C A+ D D+ Sbjct: 137 VLAGREQTMRDMRDASIARWFTADFAQANPAVAARITDMIASTSPDGYAANCAAVRDADY 196 Query: 192 TADLSRISAPTLVIAGEEDPSTPPSVMQILADGITEARFEVLSPAAHVANLEQAGAVT 249 L+ I PTL++ G +DP T + + I A V AAH++N+E A T Sbjct: 197 REQLATIKTPTLIVCGAKDPVTTVEHGEFIQANIPGAEL-VAFEAAHLSNVEAGDAFT 253 Lambda K H 0.318 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 262 Length adjustment: 28 Effective length of query: 372 Effective length of database: 234 Effective search space: 87048 Effective search space used: 87048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory