GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Pseudomonas stutzeri RCH2

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate GFF4162 Psest_4235 3-hydroxyacyl-CoA dehydrogenase

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__psRCH2:GFF4162 Psest_4235 3-hydroxyacyl-CoA
           dehydrogenase
          Length = 701

 Score =  701 bits (1809), Expect = 0.0
 Identities = 365/696 (52%), Positives = 489/696 (70%), Gaps = 10/696 (1%)

Query: 1   MSEVVTRATQDQVAIVTVDSPPVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGRTFI 60
           M++VV    Q ++A++TV++PPVNAL  AVR G+ +   +A ADP V+A+ LVC G TFI
Sbjct: 1   MTDVVRLEVQGEIALITVNNPPVNALGQAVREGLQKAFQSAEADPQVRAVALVCEGNTFI 60

Query: 61  AGADITEFGKPPQPPALNDVIAALENSPKPTIAAIHGTALGGGLEVALGCHFRVAVKEAK 120
           AGADI EFGKPPQ P+L +VI  +E   K ++A IHGTALGGGLEVALGCH+R+A K+AK
Sbjct: 61  AGADIKEFGKPPQAPSLPEVIEIIEACNKSSVAVIHGTALGGGLEVALGCHYRIARKDAK 120

Query: 121 LGLPEVKLGLLPGAGGTQRLPRAVGPELAVQMIVGGSPIGAAEALKHGLVEEVVE-NLVA 179
           +GLPEVKLGLLPGAGGTQRLPR  G E A++MIV G PI AAEA++H +V+E+ E +LV 
Sbjct: 121 VGLPEVKLGLLPGAGGTQRLPRLAGVEKALEMIVSGQPISAAEAVEHNIVDELFEGDLVE 180

Query: 180 GAVAFAKKVLAEKRPLRRLRDDDSKLAAAKADRSIFTNAVAAMTKKARGLEAPFACADAI 239
             +A+ ++++ E R  RR  +    L  A  + ++     A + K+  GL +P  C  A+
Sbjct: 181 AGLAYVRRMVEEGRTPRRTGEQTQGLEGAD-NEALIRAKHAEVAKRMPGLFSPLRCIAAV 239

Query: 240 GAAIDLPFEEGLKKEREGFMKLVVSDQSKAQRYAFFAEREAAKVDGVPDGTKPRPVSRVA 299
            AA  LP  EGLK+ERE F + + S Q  A  ++FFAER+A K++ +P  TKPR ++  A
Sbjct: 240 EAATKLPLAEGLKRERELFAECLNSPQRGALVHSFFAERQAGKINDLPSDTKPRSINSAA 299

Query: 300 IIGAGTMGGGIAMSFANAGIPVTLIETGEEQLKRGLGIMQKNWEATAARGGLPPDAPAKR 359
           +IG GTMG GIA+SFANAG+PV L+E  EE L+RGL   +  + A+  RG L  DA  +R
Sbjct: 300 VIGGGTMGVGIALSFANAGVPVKLLEINEEALQRGLQRARDTYAASVKRGSLTEDAMEQR 359

Query: 360 MALITGLVGLENVKDADLIIEAVFETMAVKKEVFTAVDAHAKPGAVLASNTSYLSIDEIA 419
           +ALI G+     + DAD+++EAVFE M VK++VF  +DA  KPGA+LASNTS L +D IA
Sbjct: 360 LALIEGVTEYAALADADVVVEAVFEEMGVKQQVFEQLDAICKPGAILASNTSSLDLDAIA 419

Query: 420 ATTKRPQDVLGMHFFSPANVMKLCEIVRGAKTAPDALLTAVSIAKKIAKVPVVVGVCDGF 479
           A TKRP+DV+G+HFFSPANVM+L E+VRGAKT+ + L TA++I K++ KV VVVGVCDGF
Sbjct: 420 AFTKRPEDVVGLHFFSPANVMRLLEVVRGAKTSDEVLATAMAIGKQLKKVSVVVGVCDGF 479

Query: 480 VGNRMLAARSKQSEKLLFEGALPQQVDAVVTKFGMPMGPFAMGDLAGLDIGWRSRKDRGI 539
           VGNRM+    +++E LL EGA PQQVDA +  FGM MGPFAM DL+GLDIG   RK +  
Sbjct: 480 VGNRMVFQYGREAEFLLEEGATPQQVDAALRNFGMAMGPFAMRDLSGLDIGQAIRKRQRA 539

Query: 540 K-------SEIADALCEAGRFGQKTGKGYYKYEQGSRAPMPDPEVETLINDTLAKLGLKR 592
                     ++D LC AG  GQKTG GYY+YE G+R P  +P++  ++     + G++R
Sbjct: 540 TLPAHLDFPTVSDKLCAAGMLGQKTGAGYYRYEPGNRTPQENPDLAPMLEAASLEKGIER 599

Query: 593 RDITDEEILERMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPMHYADSVG 652
           + + ++ I+ER ++ ++NEGA+ILEE IA R SDIDV++L GYG+P +RGGPM YADSVG
Sbjct: 600 KALDEQYIVERCIFALVNEGAKILEEGIAQRSSDIDVIYLNGYGFPAFRGGPMFYADSVG 659

Query: 653 LKHIAERLSAYAKATNDPSLEPAPLLARLAAEGKTF 688
           L  +  R+        D   +PAPLL +LAAEG+TF
Sbjct: 660 LDRVLARVKELHARCGD-WWKPAPLLEKLAAEGRTF 694


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1208
Number of extensions: 62
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 701
Length adjustment: 39
Effective length of query: 660
Effective length of database: 662
Effective search space:   436920
Effective search space used:   436920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory