Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate GFF1059 Psest_1092 Branched-chain amino acid ABC-type transport system, permease components
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__psRCH2:GFF1059 Length = 295 Score = 144 bits (363), Expect = 2e-39 Identities = 100/300 (33%), Positives = 160/300 (53%), Gaps = 20/300 (6%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSL 60 + L QL+ GL GA Y L+++G +++G++ +INFAHG YM+GAFVA FL + L Sbjct: 9 LSVLLGQLLLGLINGAFYALLSLGLAIIFGLLRIINFAHGAQYMLGAFVA---FLGLNYL 65 Query: 61 GIT-WVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQ 119 G++ W L L ++V + G +ER R + L L+ G+++ ++ Sbjct: 66 GVSYWFALVLAPLVVGCL------GMAIERGLLRRIAGEDHLYGLLLTFGLALIVEGSFV 119 Query: 120 ILQG--ARSKPLQPILPG--NLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGR 175 L G S P+ +L G NL M ++V +A +V+ +A Y +I RT LG Sbjct: 120 KLFGVSGSSYPMPELLRGGFNLGFMFLPTYRAWVIVAALVVCLATWY----VIERTRLGS 175 Query: 176 AQRACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKA 235 RA ++ K+ G+NV +++LT+ G ALAA AG++ IY V +G + Sbjct: 176 YLRAGTENPKLMQGFGINVPLLVTLTYGYGVALAAFAGVLAAPIYAVTP-GMGSNLLIVV 234 Query: 236 FTAAVLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGR 295 F V+GG+GS+ GA++ G+ +GLIE + E + F ++V VL+ RP GL G+ Sbjct: 235 FAVVVIGGMGSILGAIVTGIAMGLIEGLTKVFY-PEAANTVVFLVMVAVLLIRPAGLFGK 293 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 295 Length adjustment: 26 Effective length of query: 275 Effective length of database: 269 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory