GapMind for catabolism of small carbon sources

 

Aligments for a candidate for Pf6N2E2_5404 in Pseudomonas stutzeri RCH2

Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate GFF3102 Psest_3161 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

Query= reanno::pseudo6_N2E2:Pf6N2E2_5404
         (365 letters)



>lcl|FitnessBrowser__psRCH2:GFF3102 Psest_3161 amine acid ABC
           transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family
          Length = 365

 Score =  603 bits (1555), Expect = e-177
 Identities = 285/364 (78%), Positives = 322/364 (88%)

Query: 1   MTTHTFKPDMPPPGSSIGVVAWMRANMFSSWINTLLTLFAFYLIYLIVPPLVQWAILDAN 60
           MT HTFKPD+PPP  SIG + W+RAN+FSSWINTLLTL   YL++LIVPP+++WAI  A+
Sbjct: 1   MTIHTFKPDLPPPTISIGALGWLRANLFSSWINTLLTLVGLYLLWLIVPPVLEWAIFKAD 60

Query: 61  WVGTTRADCTKEGACWVFIQQRFGQFMYGYYPADLRWRVDLTVWLAVIGVAPLFISRFPR 120
           W G TRADC++EGACWVFIQ RFGQFMYG+YP +LRWRVD   WLA+IG APLF+ + P 
Sbjct: 61  WTGETRADCSREGACWVFIQTRFGQFMYGFYPTELRWRVDAAAWLAIIGAAPLFLRQMPH 120

Query: 121 KAIYGLSFLVLYPISAWCLLHGGVFGLDAVATSQWGGLMLTLVIATVGIVGALPLGIVLA 180
           K  YG+ +L++YP+ A+ LLHGG  GL  V TSQWGGLMLT+VIA VGI GALPLGI+LA
Sbjct: 121 KLRYGIGYLLVYPLLAYWLLHGGFLGLQTVPTSQWGGLMLTVVIAAVGIAGALPLGILLA 180

Query: 181 LGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALIGVILF 240
           LGRRS+MPAIRV+CVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMN DKLLRA++ V+ F
Sbjct: 181 LGRRSDMPAIRVLCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNLDKLLRAMLMVVFF 240

Query: 241 QSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFIALFK 300
           ++AYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRS  LVILPQALKLVIPGIVNTFIALFK
Sbjct: 241 EAAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSTLLVILPQALKLVIPGIVNTFIALFK 300

Query: 301 DTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYVFAALVFWIFCFGMSRYSMHLERKLD 360
           DTSLVIIIGLFD LNS+K+A ADP WLGM+TEGYVFAALV+W+FCFGMSRYSM LERKLD
Sbjct: 301 DTSLVIIIGLFDFLNSIKRATADPAWLGMSTEGYVFAALVYWMFCFGMSRYSMRLERKLD 360

Query: 361 TGHK 364
           TGHK
Sbjct: 361 TGHK 364


Lambda     K      H
   0.330    0.144    0.469 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 720
Number of extensions: 23
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 365
Length of database: 365
Length adjustment: 30
Effective length of query: 335
Effective length of database: 335
Effective search space:   112225
Effective search space used:   112225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory