Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate GFF2396 Psest_2444 Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Query= BRENDA::A4YDR9 (549 letters) >FitnessBrowser__psRCH2:GFF2396 Length = 544 Score = 213 bits (541), Expect = 2e-59 Identities = 152/502 (30%), Positives = 242/502 (48%), Gaps = 25/502 (4%) Query: 47 RYTYSTFYDNVMVQASALMRRGFSREDKLSFISRNRPEFLESFFGVPYAGGVLVPINFRL 106 RY Y+ AS L + G D +S ++ N E FF VP G VL N RL Sbjct: 40 RYDYACLAARSAQAASMLGKLGIGPGDCVSSLAWNTHRHYELFFAVPGIGAVLHTANPRL 99 Query: 107 SPKEMAYIINHSDSKFVVVDEPYLNSLLEVKDQIKAEIILLEDPDNPSASETARKEVRMT 166 S +++ Y INH+ S+ ++ D + + ++ ++ +E PS+ + + Sbjct: 100 SDEQIVYTINHAGSQVLLFDSSFAACVARLRPRLGNIRHFIELAAQPSSG----LQDVLG 155 Query: 167 YRELVKGGSRDPLPIPAKEEYSMITLYYTSGTTGLPKGVMHHHRGAFLNAMAEVLEHQMD 226 Y +L+ + PL P +E + L YTSGTTG PKGV++ HR L+AMA L Sbjct: 156 YEQLI--AAEQPLDWPQFDENAGAVLCYTSGTTGDPKGVLYSHRSVVLHAMAAGLSGAFG 213 Query: 227 LNSVYLWTLP---MFHAASWGFSWATVAVGATNVC-LDKVDYPLIYRLVEKERVTHMCAA 282 L S + +P ++H +WG +A G V DK+D + L++ E VT Sbjct: 214 L-SAFDCIMPCSSLYHGTAWGIPFAAAINGCKFVLPCDKMDGASLQELIKTEGVTLSGGV 272 Query: 283 PTVYVNLADYMKRNNLKFSNRVHMLVAGAAPAPATLKAMQ-EIGGYMCHVYGLTETYGPH 341 PT++ +++R+ + +++ G+A A + Q + G +C ++G+TET P Sbjct: 273 PTIWTMYLAHLERSGEDSGSLARLVIGGSAVPRAMAETFQTKYGVAVCQLWGMTET-SPL 331 Query: 342 SICEWRREWDSLPLEEQAK------LKARQGIPYVSFEMDVFDANGKPVPWDGKTIGEVV 395 + + L E+ + + RQG E+ + D G+ +P DG + G + Sbjct: 332 GVVAT----PTPKLAERGQQATNDTIWTRQGRLQFGIELKIVDEEGRELPCDGVSSGSLK 387 Query: 396 MRGHNVALGYYKNPEKTAESFRDGWFHSGDAAVVHPDGYIEIVDRFKDLINTGGEKVSSI 455 +RG YY++ + + DGWF +GD A + DG++ I DR KD+I +GGE VSSI Sbjct: 388 VRGPWTVERYYRSEKSALDE--DGWFDTGDIATLDADGFMRITDRSKDVIKSGGEWVSSI 445 Query: 456 LVEKTLMEIPGVKAVAVYGTPDEKWGEVVTARIELQEGVKLTEEEVIKFCKERLAHFECP 515 +E PGVK AV G KW E IE ++T E ++ + + + P Sbjct: 446 DIENVAAACPGVKVAAVVGVFHPKWEERPVLVIEPHADAEVTVETILAHLEPNIVKWWMP 505 Query: 516 KIVEFGPIPMTATGKMQKYVLR 537 V F +P+TATGK+ K VLR Sbjct: 506 DAVIFDAVPLTATGKIDKKVLR 527 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 549 Length of database: 544 Length adjustment: 36 Effective length of query: 513 Effective length of database: 508 Effective search space: 260604 Effective search space used: 260604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory