Align Probable c4-dicarboxylate-binding protein (characterized, see rationale)
to candidate GFF773 Psest_0787 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
Query= uniprot:Q9HVH5 (332 letters) >FitnessBrowser__psRCH2:GFF773 Length = 332 Score = 431 bits (1107), Expect = e-125 Identities = 208/332 (62%), Positives = 265/332 (79%) Query: 1 MFKPFVGVALAALFAVSAVAHAEDAGPVVIKFSHVVSDDTPKGKGALLFKKLAEERLPGK 60 M+K V +AAL+ SA A A +A P+VIKF+HVV+DDTPKGKGALL K+L E+R+ GK Sbjct: 1 MYKSCVAALVAALYWFSAPAMAAEAEPIVIKFAHVVADDTPKGKGALLLKQLVEQRMAGK 60 Query: 61 VKVEVYPNSTLFGDADEIEALRANKVQMLATSLSKFEPYTKQLQVFDLPFLFDDLEALKR 120 VKVEVYPNSTL GDA+E++AL NKVQ+LA S+SKF PYTK+LQVFDLPFLFDD EAL+R Sbjct: 61 VKVEVYPNSTLVGDAEEMQALFDNKVQLLAPSMSKFAPYTKKLQVFDLPFLFDDAEALQR 120 Query: 121 FQKRDKSRELLRSMAKHGIYGLAYWNNGMKQLSATRELHRPDDAKGLVFRIQPSSVLEAQ 180 FQKR+ +R+LLRSMA HG+YGLAYWNNG+KQLSAT L +P DA GL FRIQPS VLEAQ Sbjct: 121 FQKREAARQLLRSMADHGVYGLAYWNNGLKQLSATTPLRKPSDANGLAFRIQPSPVLEAQ 180 Query: 181 FAMLGATAKQLSYAETLKAMQAGSVQGTENTWSNLAGQKIDSVQPYITETNHGALSYMLI 240 FA +GA + L +A+ ++++ G VQG EN WSN+ Q + SVQPYITE+NHG L YMLI Sbjct: 181 FAAVGAKSVVLPFAKVYESLKGGVVQGAENPWSNILSQNMHSVQPYITESNHGVLDYMLI 240 Query: 241 TSSAFWTGIPYQTRTELESIVDEVTLVVNKEAEALNQKEREHLLAAGKSRLVSLSAEEHE 300 T++ FW +P+ R+ELE I+ EVT VN+EA A+N+++RE +LA+G S+L++L+ EE + Sbjct: 241 TNNDFWLSMPFAVRSELEGIILEVTQAVNREAAAVNRRDRERILASGSSQLITLTPEERQ 300 Query: 301 AWRNAMKPLWKNYEAQIGSDVLRAAQVVNRKR 332 AWR M P+WK YEA IG+D++RAA VNR+R Sbjct: 301 AWREQMLPVWKTYEADIGADLIRAAMTVNRRR 332 Lambda K H 0.316 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 332 Length adjustment: 28 Effective length of query: 304 Effective length of database: 304 Effective search space: 92416 Effective search space used: 92416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory