GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Pseudomonas stutzeri RCH2

Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate GFF3793 Psest_3862 phosphoenolpyruvate-protein phosphotransferase

Query= reanno::BFirm:BPHYT_RS02740
         (854 letters)



>lcl|FitnessBrowser__psRCH2:GFF3793 Psest_3862
           phosphoenolpyruvate-protein phosphotransferase
          Length = 757

 Score =  279 bits (713), Expect = 5e-79
 Identities = 187/574 (32%), Positives = 295/574 (51%), Gaps = 10/574 (1%)

Query: 285 GETLAPNTLAGVCAAPGVAVGK-LVRWDDADIDP-PEKANGTSAAESRLLDKAIATVDAD 342
           G+ +      G+  APG  VG  LV    AD+D  P+K      AE  L + A+  V AD
Sbjct: 170 GKGIQETRFIGIPGAPGAGVGTALVVLPPADLDVVPDKHIDNIDAELTLFEAALEAVRAD 229

Query: 343 LDTTVRDASQRGAVGEAGIFSVHRVLLEDPTLLDAARDLISLGKSAGFAWREAIRAQIAI 402
           +       + +    E  +F V+ ++L+D  L      +I  G+ A  A R+ +R  +  
Sbjct: 230 MRNLSEKLATQMRKEERALFDVYLMMLDDSALGGEVTKVIRTGQWAQGALRQVVREHVRR 289

Query: 403 LTNIEDALLAERAADLRDIEKRVLRALGYTSATARTLPEEAVLAAEEFTPSDLSTLDRSR 462
              ++DA L ERA+D++DI +R+L  L        T P++ +L +EE +P+ L  +   +
Sbjct: 290 FEMMDDAYLRERASDVKDIGRRLLSYLQEARQQTLTYPDKTILVSEELSPAMLGEVPEGK 349

Query: 463 VTALVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVVVNATTGRLEFAPTELD 522
           +  +V   G + SH AILAR  GIP ++   D  ++  +G +++V+   G +   P ++ 
Sbjct: 350 LVGMVSVLGSSNSHVAILARAMGIPTVMGAVDLPYSKVDGIELIVDGYRGEIITNPGKVL 409

Query: 523 VERARLERTRLADVREANRRTSQQAAVTSDGRAIEVAANIATLDDAKTAVENGADSVGLL 582
            E+  +   +   + E      +    T DG  I +  N   L D   A E GA+ VGL 
Sbjct: 410 REQYEVLAEQERQLSEGLDVLRELPCETIDGHRIPLWVNTGLLADVVRAQERGAEGVGLY 469

Query: 583 RTELLFIHRAAAPTTDEHRQSYQAIVDALSGRTAIIRTLDVGADKEVDYLTLPPEPNPAL 642
           RTE+ F+ +   P+  E    Y+  ++A       +R+LD+G DK + Y  +  E NP L
Sbjct: 470 RTEVPFMIKERFPSEKEQMAIYREQLEAFHPLPVTMRSLDIGGDKCLPYFPIKEE-NPFL 528

Query: 643 GLRGIRLAQVRPDLLDDQLRGLL-AVQPLGAVRILLPMVTDVGELIRIRKRIDEFARELG 701
           G RGIR+    P++   Q R +L A   L  +RILLPM++ +GEL      I     E+ 
Sbjct: 529 GWRGIRVTLDHPEIFLLQTRAMLKASAGLNNLRILLPMISGIGELEEALHLIHRAWCEV- 587

Query: 702 RTEPIEV-----GVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTLAMDRCQADLAAQA 756
           R E ++V     GVMIEVP+A  L  +LA+  DF+S+G+NDLTQY LA+DR    +A   
Sbjct: 588 RDEGLDVHMPPVGVMIEVPAAVYLTRELARQVDFISVGSNDLTQYLLAVDRNNPRVADLY 647

Query: 757 DGLHPAVLRLIAATVQGADKHGKWVGVCGALAGDPLAMPLLVGLGVTELSVDPVSVPGIK 816
           D LHPAVL  +   V+ A   GK V +CG +AGDP A  LL+ +G   LS++  ++P +K
Sbjct: 648 DYLHPAVLEALQRVVKEAHSEGKPVSICGEMAGDPAAAVLLLAMGFDSLSMNATNLPKVK 707

Query: 817 ARVRNLDYQLCRQRAQDALALESAQAVRAASRET 850
             +R +     +Q     + L+S Q +++  + T
Sbjct: 708 WLLRQISMDTAQQLLARVMLLDSPQVIQSTVQLT 741


Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1222
Number of extensions: 61
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 854
Length of database: 757
Length adjustment: 41
Effective length of query: 813
Effective length of database: 716
Effective search space:   582108
Effective search space used:   582108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory