Align Acetate/haloacid transporter, Dehp2, with a possible atypical topology (characterized)
to candidate GFF1547 Psest_1584 Arabinose efflux permease
Query= TCDB::F8SVK1 (552 letters) >FitnessBrowser__psRCH2:GFF1547 Length = 452 Score = 183 bits (465), Expect = 1e-50 Identities = 103/314 (32%), Positives = 160/314 (50%), Gaps = 4/314 (1%) Query: 18 KRVIFASSLGTVFEWYDFYLAGSLAAFISKSFFSGVNPTAAFIFTLLGFAAGFAVRPFGA 77 K + A+ +G EWYDF + G LA IS+ FF + +A + F GF +RP G Sbjct: 10 KNQVLAAVIGNALEWYDFIVFGFLAVVISRLFFPAESEYSALLMATATFGVGFFMRPIGG 69 Query: 78 LVFGRLGDMVGRKYTFLITIVIMGLSTCVVGFLPGYAAIGMASPVIFIAMRLLQGLALGG 137 ++ G D GRK + I +M LS ++ F P +AAIG+A+P++ + RL+QG A GG Sbjct: 70 VLLGIYADRKGRKAALQLIISLMTLSIAMIAFAPPFAAIGIAAPLLIVLARLMQGFATGG 129 Query: 138 EYGGAATYVAEHAPANRRGFYTAWIQTTATLGLFLSLLVILGVRTAMGEDAFGAWGWRIP 197 E+ A +++ E APANRRG Y +W L +F V V + + + +WGWRIP Sbjct: 130 EFASATSFLIESAPANRRGLYGSWQMFGQGLAVFCGAGVTALVTSNLSPEDLDSWGWRIP 189 Query: 198 FVASLVLLGISVWIRMQLHESPAFERIKAEGKTSKAPLSEAFGQWKNLKIVILALIGVTA 257 F+ L++ + +W+R L E+ AF + K K L+ + ++AL T Sbjct: 190 FIIGLIIGPVGLWMRRNLSETEAFLEARQAPK-EKQSLARMLRSHLRQVVTVMAL---TV 245 Query: 258 GQAVVWYTGQFYALFFLTQTLKVDGASANILIAIALLIGTPFFLFFGSLSDRIGRKPIIL 317 V +Y Y F + L + A +A+ + T FG+LSDR+GRK +++ Sbjct: 246 CGTVAFYVILVYMPTFANRQLGMQLKDAFTAQVVAVAVLTLLMPVFGALSDRVGRKLLMI 305 Query: 318 AGCLIAALTYFPLF 331 L + +PLF Sbjct: 306 VATLGLLVALYPLF 319 Score = 42.0 bits (97), Expect = 5e-08 Identities = 22/88 (25%), Positives = 47/88 (53%), Gaps = 5/88 (5%) Query: 453 MTVVILTILVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPATAFAIV 512 M +++ ++L ++ +GP +A + E FP +R T ++L Y++ FGGF ++ Sbjct: 334 MQLILCSLLAVF----FGPFSAAVAEQFPAGVRSTGLALAYNLAVMIFGGFAQFIVTWLI 389 Query: 513 AAKGNIYSGLWYPIIIALATFVIGLLFV 540 G + ++Y ++ A+ +IG F+ Sbjct: 390 QNTGMAIAPVFY-VLFAVTLGLIGSFFL 416 Lambda K H 0.325 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 590 Number of extensions: 42 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 552 Length of database: 452 Length adjustment: 34 Effective length of query: 518 Effective length of database: 418 Effective search space: 216524 Effective search space used: 216524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory