GapMind for catabolism of small carbon sources

 

Aligments for a candidate for SLC1A4 in Pseudomonas stutzeri RCH2

Align neutral amino acid transporter A (characterized)
to candidate GFF4002 Psest_4075 Na+/H+-dicarboxylate symporters

Query= CharProtDB::CH_091534
         (532 letters)



>lcl|FitnessBrowser__psRCH2:GFF4002 Psest_4075 Na+/H+-dicarboxylate
           symporters
          Length = 419

 Score =  210 bits (534), Expect = 9e-59
 Identities = 144/436 (33%), Positives = 225/436 (51%), Gaps = 58/436 (13%)

Query: 52  VLAGAGLGAALRGLSLSRTQVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASL-DASCL 110
           +L G  LG A  G++        LA  G + L  ++M+I+PLV  SLV+G  S+ D++ L
Sbjct: 23  ILIGLALGVAA-GMAFG-ADAQLLAPIGTLFLNAIKMLIVPLVFVSLVAGITSMQDSAKL 80

Query: 111 GRLGGIAVAYFGLTTLSASALAVALAFIIKPGSGAQTLQSSDLGLEDSGPPPVPKETVDS 170
           GR+    +A + +TT  A ++ +    +  PG G   + S   G E +   P       S
Sbjct: 81  GRISLKTIAIYLVTTAFAVSIGLLFGALFSPGEGMNMVAS---GNEQAKQAP-------S 130

Query: 171 FLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEGMNILGLVLFA 230
            + +   L P+N                              P+    EG NIL +++FA
Sbjct: 131 LVSILVGLVPAN------------------------------PVTAFAEG-NILQIIVFA 159

Query: 231 LVLGVALKKLGSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFL----VGSKIVEMKD 286
           + LGV++  +G  G   +R F++L E    L   +M   P+G+  L    VGS   E+  
Sbjct: 160 IALGVSINLIGERGAPAVRLFDALAETFYKLTDLVMRVAPIGVFALTAGVVGSHGAEV-- 217

Query: 287 IIVLVTSLGKYIFASILGHV--IHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCS 344
           ++ L   +G    ASI  HV  ++GG++      +  R NP RF  G+    A AF+T S
Sbjct: 218 LLPLAGVIGVIYLASI-AHVLLVYGGLL-----GLLARLNPLRFFQGIAPALAVAFSTSS 271

Query: 345 SSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAG 404
           SS TLP  ++C  +N GV + ++ F+LP+GAT+NMDG AI+Q V A+FIAQ   ++L+AG
Sbjct: 272 SSGTLPVSIECARKNLGVSEGVAGFVLPVGATINMDGTAIYQGVLALFIAQAFGIDLSAG 331

Query: 405 QIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNV 464
           Q   I++TAT +S+G AG+P  G++ + ++L A GLP   + LI  +D I+D   T VNV
Sbjct: 332 QYAMIILTATLASIGTAGIPGAGLIMLGLVLTAAGLPLEGVALIAGIDRILDMARTTVNV 391

Query: 465 EGDALGAGILHHLNQK 480
            GD +   ++    Q+
Sbjct: 392 AGDLMTTTLVGRSEQE 407


Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 395
Number of extensions: 18
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 532
Length of database: 419
Length adjustment: 33
Effective length of query: 499
Effective length of database: 386
Effective search space:   192614
Effective search space used:   192614
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory