Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate GFF2309 Psest_2357 Short-chain dehydrogenases of various substrate specificities
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >FitnessBrowser__psRCH2:GFF2309 Length = 262 Score = 108 bits (270), Expect = 1e-28 Identities = 94/254 (37%), Positives = 125/254 (49%), Gaps = 19/254 (7%) Query: 25 RTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADEL-GDSKHKPLFLSCDLT 83 R V+ITG A GIG + FAA GA + D DA A LADEL GD+ + L DL Sbjct: 10 RCVVITGAAGGIGRGLAQSFAAAGATLELLDRDADALARLADELAGDAPLRCTAL--DLG 67 Query: 84 DIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRES---FDAGIAVNIRHQFFAA 140 D A+Q+ D+ VLVNNA + + E + E+ + + N+ Sbjct: 68 DRQAVQRYADDLACRGLHADVLVNNAGVEYATPLDECSFEADQCWSTLLENNVGSMQRLT 127 Query: 141 QAVMEDMKAANSGSIINLGSISWMLKN-GGYPVYVMSKSAVQGLTRGLARDLGHFNIRVN 199 +A++ ++A S+IN SI W LK G+ YV SK AV GLTR LA +LG IRVN Sbjct: 128 RALLPRLRAG--ASVINQASI-WGLKGVPGFSAYVASKHAVVGLTRSLAWELGPRRIRVN 184 Query: 200 TLVPGWVMTEKQKRLW--LDDAGRRS-------IKEGQCIDAELEPADLARMALFLAADD 250 + PGW+ T+ R + DA RS I Q I L PADL LFL + Sbjct: 185 AVCPGWIATDAAMRSLQVMADANGRSDSAELATILSNQAIPELLTPADLGGTFLFLGSPL 244 Query: 251 SRMITAQDIVVDGG 264 + +T Q + V G Sbjct: 245 AAALTGQALSVSHG 258 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 262 Length adjustment: 25 Effective length of query: 241 Effective length of database: 237 Effective search space: 57117 Effective search space used: 57117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory