Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate GFF3457 Psest_3522 3-hydroxybutyrate dehydrogenase
Query= reanno::HerbieS:HSERO_RS05210 (261 letters) >FitnessBrowser__psRCH2:GFF3457 Length = 256 Score = 101 bits (252), Expect = 1e-26 Identities = 76/256 (29%), Positives = 112/256 (43%), Gaps = 14/256 (5%) Query: 15 SLKGKRVFITGGGTGIGAAIVEAFAQQGAHVAFVDIATEASEALCNEVAAAGHPKPLFRH 74 +L GK +TG +GIG I A+ GA + +AS AL H + + H Sbjct: 2 NLTGKTALVTGSTSGIGLGIALKLAEAGADLILNGFG-DASAALAE---VGRHGRKVGHH 57 Query: 75 -CDLRDIPAFQATIAELQAQLGDFDVLVNNAANDQRHKLEEVTLEYWNDRIAINQRPSFF 133 D+ D A + G D+LVNNA +EE +E W+ IAIN +F Sbjct: 58 GADVSDPAQIAELFAYAERDFGGVDILVNNAGIQHVAPVEEFPVERWDAIIAINLSSAFH 117 Query: 134 AVQSVVEGMKRRGGGSIINFSSISWHQSGGGFPVYTTAKASTLGLTRGLARDLGPHKIRV 193 + + GM++RG G IIN +S+ Y AK +GLT+ +A + I Sbjct: 118 TTRLALPGMRQRGWGRIINIASVHGLVGSEQKAAYVAAKHGLVGLTKVVALETATTPITC 177 Query: 194 NTVTPGWVMT---ERQIKLWLDEEGKKAIARNQCLQGD------LLPWHLARMVLFLAAD 244 N + PGWV+T ++QI E G + AR+ L + P L M LFL ++ Sbjct: 178 NAICPGWVLTPLVQQQIDERARESGDEQQARHDLLAEKQPSLDFVTPAQLGAMALFLCSE 237 Query: 245 DSAMCTAQEFIVDAGW 260 + +D GW Sbjct: 238 AGDQVRGAAWNMDGGW 253 Lambda K H 0.321 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 256 Length adjustment: 24 Effective length of query: 237 Effective length of database: 232 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory