GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aguA in Pseudomonas stutzeri RCH2

Align agmatine deiminase (EC 3.5.3.12) (characterized)
to candidate GFF4218 Psest_4291 agmatine deiminase

Query= BRENDA::Q9I6J9
         (368 letters)



>lcl|FitnessBrowser__psRCH2:GFF4218 Psest_4291 agmatine deiminase
          Length = 368

 Score =  603 bits (1555), Expect = e-177
 Identities = 282/365 (77%), Positives = 318/365 (87%)

Query: 1   MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQAAFAAVAKAIARFEPV 60
           M+  T+TPR DG+ MPAEW PH QTWMVWP+RPDNWR+ G PAQAAF AVAKAIARFEPV
Sbjct: 1   MTTLTTTPRTDGYFMPAEWAPHSQTWMVWPQRPDNWRDNGSPAQAAFTAVAKAIARFEPV 60

Query: 61  TVCASAGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVIDDKGDVRGVDWGFNAWGG 120
           TVCASA +Y  ARA L+D  IRVVEIS+DDAWVRDTGPTF++DD G +RGVDW FNAWGG
Sbjct: 61  TVCASAEEYLAARAALNDPRIRVVEISTDDAWVRDTGPTFIVDDNGGLRGVDWTFNAWGG 120

Query: 121 FEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVDGEGTLITTEECLLNHNR 180
            +GGLY  WQRDD+VARKILEIE   RYRT+ FVLEGGSIHVDG+GTLITTEECLLN NR
Sbjct: 121 EDGGLYADWQRDDEVARKILEIEYCDRYRTEGFVLEGGSIHVDGQGTLITTEECLLNRNR 180

Query: 181 NPHLSQAEIERTLRDYLAVESIIWLPNGLYNDETDGHVDNFCCYARPGEVLLAWTDDQDD 240
           NP L++ +IE  LR++LAV+SIIWLP+GL+NDETDGHVDNFCC+ RPGEVLLAWTDD +D
Sbjct: 181 NPQLTREQIEAVLREHLAVDSIIWLPHGLFNDETDGHVDNFCCFVRPGEVLLAWTDDAND 240

Query: 241 PNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRL 300
           PN+ RCQAA+ VL+ +RDAKGR L VHKMPIPGPL+AT EEC GV  ++GSQPRDPS+RL
Sbjct: 241 PNFERCQAAMAVLQNARDAKGRALTVHKMPIPGPLHATAEECAGVVALDGSQPRDPSVRL 300

Query: 301 AGSYVNFLIVNGGIIAPSFDDPKDAEARAILQRVFPEHEVVMVPGREILLGGGNIHCITQ 360
           AGSYVNFLIVNGGIIAP+F DP DAEA  IL +VFPEH+VVM PGREILLGGGNIHCITQ
Sbjct: 301 AGSYVNFLIVNGGIIAPAFGDPLDAEAERILAQVFPEHQVVMAPGREILLGGGNIHCITQ 360

Query: 361 QQPAP 365
           QQPAP
Sbjct: 361 QQPAP 365


Lambda     K      H
   0.319    0.138    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 664
Number of extensions: 23
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 368
Length of database: 368
Length adjustment: 30
Effective length of query: 338
Effective length of database: 338
Effective search space:   114244
Effective search space used:   114244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate GFF4218 Psest_4291 (agmatine deiminase)
to HMM TIGR03380 (aguA: agmatine deiminase (EC 3.5.3.12))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03380.hmm
# target sequence database:        /tmp/gapView.11814.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03380  [M=357]
Accession:   TIGR03380
Description: agmatine_aguA: agmatine deiminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   9.3e-176  570.0   0.0   1.1e-175  569.8   0.0    1.0  1  lcl|FitnessBrowser__psRCH2:GFF4218  Psest_4291 agmatine deiminase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__psRCH2:GFF4218  Psest_4291 agmatine deiminase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  569.8   0.0  1.1e-175  1.1e-175       1     357 []       6     364 ..       6     364 .. 0.99

  Alignments for each domain:
  == domain 1  score: 569.8 bits;  conditional E-value: 1.1e-175
                           TIGR03380   1 ttpkedgfrlPaefekqkevwliWPerpDnWregakpaqkafaevakaiakvepvtvlvskeqyenarkalpe.e 74 
                                         ttp+ dg+++Pae+++++++w++WP+rpDnWr+++ paq+af++vakaia++epvtv++s+e+y  ar+al++ +
  lcl|FitnessBrowser__psRCH2:GFF4218   6 TTPRTDGYFMPAEWAPHSQTWMVWPQRPDNWRDNGSPAQAAFTAVAKAIARFEPVTVCASAEEYLAARAALNDpR 80 
                                         69*********************************************************************9879 PP

                           TIGR03380  75 irvvemssnDawirDvGPtfvvndkgelrgvdwefnawgglkdGlyfpWdkDdkvarkvleleridryra.dlvl 148
                                         irvve+s++Daw+rD+GPtf+v+d+g lrgvdw+fnawgg ++Gly++W++Dd+vark+le+e  dryr+  +vl
  lcl|FitnessBrowser__psRCH2:GFF4218  81 IRVVEISTDDAWVRDTGPTFIVDDNGGLRGVDWTFNAWGGEDGGLYADWQRDDEVARKILEIEYCDRYRTeGFVL 155
                                         **********************************************************************89*** PP

                           TIGR03380 149 eggsihvDGeGtlltteeclLsegrnpelskeeieeklkeylgvekviWlkeGlyldetnGhvDnllnfvrPGev 223
                                         eggsihvDG+Gtl+tteeclL+++rnp+l++e+ie++l+e+l+v+++iWl++Gl++det+GhvDn+++fvrPGev
  lcl|FitnessBrowser__psRCH2:GFF4218 156 EGGSIHVDGQGTLITTEECLLNRNRNPQLTREQIEAVLREHLAVDSIIWLPHGLFNDETDGHVDNFCCFVRPGEV 230
                                         *************************************************************************** PP

                           TIGR03380 224 vlswtddesdPqyeiskealevLenetDakGrklkvhklklpeplllteeeakgvdavegtlpreagerlaasyv 298
                                         +l+wtdd +dP++e++++a+ vL+n++DakGr l+vhk+++p+pl++t+ee++gv a +g++pr+++ rla+syv
  lcl|FitnessBrowser__psRCH2:GFF4218 231 LLAWTDDANDPNFERCQAAMAVLQNARDAKGRALTVHKMPIPGPLHATAEECAGVVALDGSQPRDPSVRLAGSYV 305
                                         *************************************************************************** PP

                           TIGR03380 299 nyliankaiilPlfddekDkeakkllqelfPdrkvvgvkareillgGGnihcitqqipa 357
                                         n+li+n++ii+P f+d+ D+ea+++l+++fP+++vv+ + reillgGGnihcitqq+pa
  lcl|FitnessBrowser__psRCH2:GFF4218 306 NFLIVNGGIIAPAFGDPLDAEAERILAQVFPEHQVVMAPGREILLGGGNIHCITQQQPA 364
                                         *********************************************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (357 nodes)
Target sequences:                          1  (368 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 6.95
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory