Align N-carbamoylputrescine amidase; Nitrilase-like protein 1; EC 3.5.1.53 (characterized)
to candidate GFF4217 Psest_4290 N-carbamoylputrescine amidase
Query= SwissProt::Q8VYF5 (299 letters) >lcl|FitnessBrowser__psRCH2:GFF4217 Psest_4290 N-carbamoylputrescine amidase Length = 293 Score = 376 bits (966), Expect = e-109 Identities = 185/291 (63%), Positives = 221/291 (75%), Gaps = 4/291 (1%) Query: 8 REVVVSSLQFACSDDISTNVAAAERLVREAHAKGANIILIQELFEGYYFCQAQREDFFKR 67 R V V++ Q ACS D N+A A++LVREA AKGA IILIQELFE YFCQ ++ + Sbjct: 3 RVVTVAATQMACSWDRQANIANADKLVREAAAKGAQIILIQELFETPYFCQKPNAEYLQL 62 Query: 68 AKPYKNHPTIARMQKLAKELGVVIPVSFFEEANTAHYNSIAIIDADGTDLGIYRKSHIPD 127 A P + +P I QK+A EL VV+P+SFFE A A +NSIAIIDADG LG+YRKSHIPD Sbjct: 63 ATPVEENPAIQHFQKVAAELQVVLPISFFELAGRARFNSIAIIDADGKLLGVYRKSHIPD 122 Query: 128 GPGYQEKFYFNPGDTGFKVFQTKFAKIGVAICWDQWFPEAARAMVLQGAEILFYPTAIGS 187 GPGY EK+YFNPGDTGFKV+ T++AKIGVAICWDQWFPE AR+M L GAE+LFYPTAIGS Sbjct: 123 GPGYHEKYYFNPGDTGFKVWNTRYAKIGVAICWDQWFPETARSMALMGAELLFYPTAIGS 182 Query: 188 EPQDQGLDSRDHWRRVMQGHAGANVVPLVASNRIGKEIIETEHGPSQITFYGTSFIAGPT 247 EP D + SRDHW+RV QGHAGAN++PL+ASNRIG+E E ITFYG+SFIA Sbjct: 183 EPHDPNITSRDHWQRVQQGHAGANLMPLIASNRIGRE----EQDGYDITFYGSSFIADQF 238 Query: 248 GEIVAEADDKSEAVLVAQFDLDMIKSKRQSWGVFRDRRPDLYKVLLTMDGN 298 G V E D+ SE VLV QFDLD ++ R +WGVFRDRRP+LY + T+DG+ Sbjct: 239 GAKVEEMDETSEGVLVHQFDLDQLEHIRSAWGVFRDRRPNLYGSIRTLDGS 289 Lambda K H 0.321 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 293 Length adjustment: 26 Effective length of query: 273 Effective length of database: 267 Effective search space: 72891 Effective search space used: 72891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate GFF4217 Psest_4290 (N-carbamoylputrescine amidase)
to HMM TIGR03381 (aguB: N-carbamoylputrescine amidase (EC 3.5.1.53))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03381.hmm # target sequence database: /tmp/gapView.13102.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03381 [M=279] Accession: TIGR03381 Description: agmatine_aguB: N-carbamoylputrescine amidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-150 486.7 0.0 1.2e-150 486.5 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF4217 Psest_4290 N-carbamoylputrescine Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF4217 Psest_4290 N-carbamoylputrescine amidase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 486.5 0.0 1.2e-150 1.2e-150 1 278 [. 5 282 .. 5 283 .. 0.99 Alignments for each domain: == domain 1 score: 486.5 bits; conditional E-value: 1.2e-150 TIGR03381 1 vkvaavqlalsedveeniekaeklvreaaakGaqiillpelfeapyfckeqeeeyfelakpveehplikrlqkla 75 v+vaa+q+a+s+d ++ni++a+klvreaaakGaqiil++elfe+pyfc++ ++ey++la+pvee+p+i+++qk+a lcl|FitnessBrowser__psRCH2:GFF4217 5 VTVAATQMACSWDRQANIANADKLVREAAAKGAQIILIQELFETPYFCQKPNAEYLQLATPVEENPAIQHFQKVA 79 79************************************************************************* PP TIGR03381 76 kelevvlpvsffekagnalynslavidadGevlgvyrkshiPdgpgyeekfyfkpGdtGfkvwdtryakiGvgic 150 +el+vvlp+sffe ag+a++ns+a+idadG+ lgvyrkshiPdgpgy+ek+yf+pGdtGfkvw+tryakiGv+ic lcl|FitnessBrowser__psRCH2:GFF4217 80 AELQVVLPISFFELAGRARFNSIAIIDADGKLLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWNTRYAKIGVAIC 154 *************************************************************************** PP TIGR03381 151 WdqWfpeaaralalkGaevllyPtaiGsePadaeldskehWqramqGhaaanvvpvvaanrigkeveaeleltfy 225 WdqWfpe+ar++al+Gae+l+yPtaiGseP+d+++ s++hWqr++qGha an++p++a+nrig+e+++++++tfy lcl|FitnessBrowser__psRCH2:GFF4217 155 WDQWFPETARSMALMGAELLFYPTAIGSEPHDPNITSRDHWQRVQQGHAGANLMPLIASNRIGREEQDGYDITFY 229 *************************************************************************** PP TIGR03381 226 GssfiadetGelvaeadrseeavlvaefdldeiakeraawGlfrdrrpelyek 278 Gssfiad+ G++v+e+d++ e+vlv++fdld++++ r+awG+frdrrp+ly + lcl|FitnessBrowser__psRCH2:GFF4217 230 GSSFIADQFGAKVEEMDETSEGVLVHQFDLDQLEHIRSAWGVFRDRRPNLYGS 282 ***************************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (279 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.13 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory