Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate GFF973 Psest_1004 Aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__psRCH2:GFF973 Length = 390 Score = 167 bits (422), Expect = 6e-46 Identities = 113/356 (31%), Positives = 166/356 (46%), Gaps = 5/356 (1%) Query: 30 QGEEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQA 89 QG +++ L +G+PDF T APIV A +L AG+T Y RG LR+ IA + +R G + Sbjct: 30 QGHDVIHLEIGEPDFTTAAPIVAAGQAALAAGHTRYTPARGLPQLREAIAAFYAQRYGLS 89 Query: 90 VDAEQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVRSEN 149 +D ++++ G AL L++PG ++A+P Y VPV + Sbjct: 90 IDPGRILITPGGSGALLLAASLLVDPGKHWLLADPGYPCNRHFLRLVEGAAQLVPVGPDV 149 Query: 150 GFRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAHDLWMISDEVYSE 209 +++ E V + + SP NP+G L R L+ ++ DE+Y Sbjct: 150 RYQLTPELVERYWDRDSVGALVASPANPTGTLLERDELARLSAALKERGGHLVVDEIYHG 209 Query: 210 LLFDGEHVSPASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCMLYG 269 L + V AS+ + D LNS SK MTGWR+GW+V P LE LA + Sbjct: 210 LTYG---VDAASVLEVDDDAFVLNSFSKYFGMTGWRLGWLVAPPTAVPELEKLAQNLYIS 266 Query: 270 SPEFIQDAACTALE-APLPELEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVMVDI 328 +P Q AA E A L LEA R + RRRD ++ L + + P G ++ DI Sbjct: 267 APSMAQHAALACFEPATLEILEARRAEFARRRDFLLPALRELGFGIAVEPQGAFYLYADI 326 Query: 329 RPTGLSAQAFADRLLDRHGVSVLAGEAFGPSAAG-HIRLGLVLGAEPLREACRRIA 383 G A AF +L+ V++ G FG AG H+R L++A RIA Sbjct: 327 SAFGGDAYAFCQHMLETEFVAITPGLDFGRFQAGHHVRFAYTQDLPRLQQAVERIA 382 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 390 Length adjustment: 31 Effective length of query: 362 Effective length of database: 359 Effective search space: 129958 Effective search space used: 129958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory