GapMind for catabolism of small carbon sources

 

Aligments for a candidate for braD in Pseudomonas stutzeri RCH2

Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF1278 Psest_1311 Branched-chain amino acid ABC-type transport system, permease components

Query= uniprot:Q1MCU0
         (300 letters)



>lcl|FitnessBrowser__psRCH2:GFF1278 Psest_1311 Branched-chain amino
           acid ABC-type transport system, permease components
          Length = 307

 Score =  296 bits (759), Expect = 3e-85
 Identities = 157/304 (51%), Positives = 215/304 (70%), Gaps = 8/304 (2%)

Query: 3   YFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFA 62
           +++QQL+NGLT+GS Y L+AIGYTMVYGIIGMINFAHG+++M+G +   I  + L+ +  
Sbjct: 6   HYLQQLINGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVTFIAIVGLSMM-- 63

Query: 63  GLPVAVLLLV-MLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQV 121
           GL    +L++   V AM++TS + ++IERVAYRPLRGS RL PLI+AIGMSI L N + +
Sbjct: 64  GLDALPILMIGAFVAAMIVTSAYGYSIERVAYRPLRGSNRLIPLISAIGMSIFLQNVVLL 123

Query: 122 TQGPRNKPIPPMVSSVYQFGN-----ISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQ 176
            Q  ++K IP ++      G      + +S  QI+I V+T V +      ++R+ LGRA 
Sbjct: 124 AQDSKDKAIPNLMPGNLVIGESAMNGVVISYMQILIFVVTFVAMYGLTLFISRSRLGRAC 183

Query: 177 RATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFT 236
           RA  +D KMA LLG+N +  I++TFV+GAALAAVA  +  M YGV + + GF  G+KAFT
Sbjct: 184 RACAEDLKMANLLGINTNSIIALTFVIGAALAAVAAVLISMQYGVINPHIGFLAGIKAFT 243

Query: 237 AAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGRPE 296
           AAVLGGIGS+PGA+ GGL++G+ E+  +  F   YKDV  F++L  VL+F+PTGILGRPE
Sbjct: 244 AAVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFSLLILVLLFRPTGILGRPE 303

Query: 297 VEKV 300
           VEKV
Sbjct: 304 VEKV 307


Lambda     K      H
   0.329    0.143    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 354
Number of extensions: 17
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 300
Length of database: 307
Length adjustment: 27
Effective length of query: 273
Effective length of database: 280
Effective search space:    76440
Effective search space used:    76440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory