GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabD in Pseudomonas stutzeri RCH2

Align succinate-semialdehyde dehydrogenase (NADP+) [EC: 1.2.1.16] (characterized)
to candidate GFF3587 Psest_3654 succinate-semialdehyde dehydrogenase

Query= reanno::MR1:200453
         (482 letters)



>lcl|FitnessBrowser__psRCH2:GFF3587 Psest_3654
           succinate-semialdehyde dehydrogenase
          Length = 488

 Score =  737 bits (1902), Expect = 0.0
 Identities = 361/481 (75%), Positives = 413/481 (85%), Gaps = 3/481 (0%)

Query: 3   LNDPSLLRQQCYINGQWCDANSKETVAITNPATGAVIACVPVMGQAETQAAIAAAEAALP 62
           L  P LLRQ  Y+NG+WC+A+S     I NPATG +I  VP MG+ ET+ AI AA+AA P
Sbjct: 5   LGQPDLLRQTAYLNGEWCEADSGARTEIFNPATGELIGAVPNMGRGETRRAIEAAQAAQP 64

Query: 63  AWRALTAKERGAKLRRWFELLNENSDDLALLMTSEQGKPLTEAKGEVTYAASFIEWFAEE 122
           AWRALTAKER A+LRRW+EL+ EN +DLA +MT+EQGKPL EA+GEV YAASF+EWFAEE
Sbjct: 65  AWRALTAKERAARLRRWYELMLENQEDLARIMTAEQGKPLAEARGEVAYAASFLEWFAEE 124

Query: 123 AKRIYGDTIPGHQGDKRIMVIKQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMVVKPA 182
            KR+YGD IP H GDKRI+V K+PVGVTAAITPWNFP+AMITRKA PALAAGC MV+KPA
Sbjct: 125 GKRLYGDVIPAHAGDKRILVQKEPVGVTAAITPWNFPSAMITRKAGPALAAGCAMVLKPA 184

Query: 183 PQTPFTALALAVLAERAGIPAGVFSVITGDAIA---IGNEMCTNPIVRKLSFTGSTNVGI 239
           PQTPF+ALALA LAERAGIPAG+ SVIT DA     +G E+C NPIVRKLSFTGST VGI
Sbjct: 185 PQTPFSALALAALAERAGIPAGLLSVITADAATSREVGAELCENPIVRKLSFTGSTAVGI 244

Query: 240 KLMAQCAPTLKKLSLELGGNAPFIVFDDANIDAAVEGAMIAKYRNAGQTCVCANRIYVQA 299
           KLM QCAPTLKKLSLELGGNAPFIVFDDA++DAAVEGAMI+KYRNAGQTCVCANRIYVQ 
Sbjct: 245 KLMQQCAPTLKKLSLELGGNAPFIVFDDADLDAAVEGAMISKYRNAGQTCVCANRIYVQD 304

Query: 300 GVYDEFAEKLSMAVAKLKVGEGIIAGVTTGPLINAAAVEKVQSHLEDAIKKGATVLAGGK 359
           G+YD F +KLS AVA+LKVG G   GVTTGPLI+AAAV KVQ HL+DA+ KGAT+LAGGK
Sbjct: 305 GIYDAFVDKLSAAVARLKVGNGAEEGVTTGPLIDAAAVAKVQRHLQDALDKGATLLAGGK 364

Query: 360 VHELGGNFFEPTVLTNADKSMRVAREETFGPLAPLFKFNDVDDVIKQANDTEFGLAAYFY 419
            H LGGNFFEPT++      M VAREETFGPLAPLF+F D D+VI+QANDTEFGLAAYFY
Sbjct: 365 PHALGGNFFEPTLVGGVTSEMAVAREETFGPLAPLFRFRDEDEVIRQANDTEFGLAAYFY 424

Query: 420 GRDISLVWKVAESLEYGMVGVNTGLISTEVAPFGGMKSSGLGREGSKYGIEEYLEIKYIC 479
            RD+S V++VAE+LEYGMVG+NTG+ISTEVAPFGGMK+SGLGREGSKYG++EY+EIKY+C
Sbjct: 425 ARDLSRVFRVAEALEYGMVGINTGVISTEVAPFGGMKASGLGREGSKYGLDEYVEIKYLC 484

Query: 480 M 480
           +
Sbjct: 485 L 485


Lambda     K      H
   0.318    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 757
Number of extensions: 17
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 482
Length of database: 488
Length adjustment: 34
Effective length of query: 448
Effective length of database: 454
Effective search space:   203392
Effective search space used:   203392
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory