Align ornithine decarboxylase (EC 4.1.1.17) (characterized)
to candidate GFF3695 Psest_3764 diaminopimelate decarboxylase
Query= BRENDA::G4XUJ8 (413 letters) >FitnessBrowser__psRCH2:GFF3695 Length = 415 Score = 84.3 bits (207), Expect = 6e-21 Identities = 70/236 (29%), Positives = 108/236 (45%), Gaps = 16/236 (6%) Query: 74 YAVKCNPEPALLGSLAAMGANFDCASRAEIEAVLSLRVSPDRIVYANPCKQESHIKYAAS 133 +AVK N +L LA +GA FD SR E+E VL+ PDRIV++ K ++ A Sbjct: 57 FAVKANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGQPDRIVFSGVGKTRDDMRRALE 116 Query: 134 VGVNLTTFDSKDELEKMR----KWHPKCALLLRVKAPEDGGARCPLGP-----KYGA-LP 183 VGV+ +S DELE+++ + K + LRV D G + K+G + Sbjct: 117 VGVHCFNVESTDELERLQQVAAELGKKAPVSLRVNPDVDAGTHPYISTGLKENKFGIDID 176 Query: 184 EEVIPLLQAAQAARLSVVGASFHIGSGATHFSSYRGAIAEAKKVFETAVKMGMPRMTMLN 243 +AA+ L VVG HIGS T + A+ + + G+ ++ L+ Sbjct: 177 NAEAVYARAAELPNLEVVGVDCHIGSQLTSLPPFLDALDRLLALTDRLAARGI-QIRHLD 235 Query: 244 IGGGFTAGSQFDE---AATAIKSALQTYFPNEPGLTIISEPGRFFAESAFTLATNV 296 +GGG + ++ A I++ Q GL ++ EPGR +A L T V Sbjct: 236 LGGGLGVRYRDEQPPLAGDYIQAVRQRI--EGRGLALVFEPGRSIVANAGVLLTRV 289 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 415 Length adjustment: 31 Effective length of query: 382 Effective length of database: 384 Effective search space: 146688 Effective search space used: 146688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory