Align ATPase (characterized, see rationale)
to candidate GFF4241 Psest_4314 ABC-type metal ion transport system, ATPase component
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__psRCH2:GFF4241 Length = 335 Score = 164 bits (415), Expect = 2e-45 Identities = 105/248 (42%), Positives = 139/248 (56%), Gaps = 13/248 (5%) Query: 21 MIYAEGVEKWY---GNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRG 77 MI V K Y G AL L + GEV ++G SG+GKST LR +N LE G Sbjct: 1 MIEFHQVHKTYRTGGRDVPALQPTQLEIASGEVFGLIGHSGAGKSTLLRLINRLEEPSGG 60 Query: 78 EIWIEGHRLSH-DRRDIATIRQEVGMVFQQFNLFPHLTVLQN----LMLAPVQVRRWPVA 132 I + G ++ D + RQ VGM+FQ FNL TV N L LA ++ RR Sbjct: 61 RILVNGEDVTALDADGLRRFRQRVGMIFQHFNLLMSKTVADNVAMPLRLAGIRSRR---- 116 Query: 133 QAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEM 192 + +A LLERV + E A KYP QLSGGQ+QRV IARALA +P ILL DE TSALDP+ Sbjct: 117 EIDARVAALLERVGLKEHARKYPAQLSGGQKQRVGIARALATEPSILLCDEATSALDPQT 176 Query: 193 VREVLDVMRDLASE-GMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSD 251 VL ++ ++ E +T+++ THE+ R V DRV +M G IVE+ P F P+ Sbjct: 177 TASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGAIVEQGPVTEVFLHPKHP 236 Query: 252 RAKQFLAQ 259 ++F+ + Sbjct: 237 TTQRFVLE 244 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 335 Length adjustment: 26 Effective length of query: 235 Effective length of database: 309 Effective search space: 72615 Effective search space used: 72615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory