GapMind for catabolism of small carbon sources

 

Aligments for a candidate for natH in Pseudomonas stutzeri RCH2

Align Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale)
to candidate GFF3102 Psest_3161 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

Query= uniprot:Q31RN9
         (396 letters)



>lcl|FitnessBrowser__psRCH2:GFF3102 Psest_3161 amine acid ABC
           transporter, permease protein, 3-TM region,
           His/Glu/Gln/Arg/opine family
          Length = 365

 Score =  248 bits (633), Expect = 2e-70
 Identities = 145/379 (38%), Positives = 218/379 (57%), Gaps = 40/379 (10%)

Query: 15  IAWLRQNLFSSWLNSAITLLLVVIIVTVVGRLGLWITTEARWTVLVDNWTLFFVGRYPAA 74
           + WLR NLFSSW+N+ +TL+ + ++  +V  +  W   +A WT            R   +
Sbjct: 20  LGWLRANLFSSWINTLLTLVGLYLLWLIVPPVLEWAIFKADWTGET---------RADCS 70

Query: 75  EQWRLWLWLGLLSPTLGLTWGCLATGSHRWQRRSLWGWAGLAAAIAGIPLPWFPHKLGLA 134
            +   W+++       G           RW R     W  +  A A + L   PHKL   
Sbjct: 71  REGACWVFI---QTRFGQFMYGFYPTELRW-RVDAAAWLAIIGA-APLFLRQMPHKLRY- 124

Query: 135 AIAATVPAASWLAQRCRGQAWLRFLPTLWGVLFLVGLWLLQGG-LGLRPVSSNDWSGLLL 193
                            G  +L   P       L+  WLL GG LGL+ V ++ W GL+L
Sbjct: 125 -----------------GIGYLLVYP-------LLAYWLLHGGFLGLQTVPTSQWGGLML 160

Query: 194 TLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVMVPLM 253
           T+  A + +  +LPLGILLALGR+S +PAIR L VT+IE +RG+PL+T+LF   VM+PL 
Sbjct: 161 TVVIAAVGIAGALPLGILLALGRRSDMPAIRVLCVTFIEFWRGVPLITVLFMSSVMLPLF 220

Query: 254 LDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLNLFQTYRFIVL 313
           L     +D++LRA++ +  F +AY+AE VRGGLQAIP+GQ+EAAAA+GL  +++   ++L
Sbjct: 221 LPEGMNLDKLLRAMLMVVFFEAAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSTLLVIL 280

Query: 314 PQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGRYAEVYLFLGVL 373
           PQAL++ IP IV  F+ L +DT+L+ I+GL + L   +   A+PA+LG   E Y+F  ++
Sbjct: 281 PQALKLVIPGIVNTFIALFKDTSLVIIIGLFDFLNSIKRATADPAWLGMSTEGYVFAALV 340

Query: 374 YWLCCYGLAQLSRRLEQRL 392
           YW+ C+G+++ S RLE++L
Sbjct: 341 YWMFCFGMSRYSMRLERKL 359


Lambda     K      H
   0.329    0.142    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 480
Number of extensions: 24
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 396
Length of database: 365
Length adjustment: 30
Effective length of query: 366
Effective length of database: 335
Effective search space:   122610
Effective search space used:   122610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory