Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate GFF3103 Psest_3162 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__psRCH2:GFF3103 Length = 394 Score = 89.7 bits (221), Expect = 7e-23 Identities = 49/129 (37%), Positives = 80/129 (62%), Gaps = 1/129 (0%) Query: 97 LISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVP 156 L+S +VA S++ AA+ E +R+GIQS+S GQ+ AA +LG+ Q ++L+I+PQA R +VP Sbjct: 262 LVSIVVALSVYTAAFIGETVRSGIQSVSHGQTEAAASLGLRPGQVLRLVIVPQALRVIVP 321 Query: 157 LLLTQGIVLFQDTSLVYVLSLADFFRT-ASTIGERDGTQVEMILFAGFVYFVISLSASLL 215 L +Q + L +++SL + D A T+ + G +E + VY IS+S SLL Sbjct: 322 PLTSQYLNLAKNSSLAAAIGYPDMVSLFAGTVLNQTGQAIETMAITMSVYLAISISISLL 381 Query: 216 VSYLKRRTA 224 +++ +R A Sbjct: 382 MNWYNKRIA 390 Score = 40.8 bits (94), Expect = 4e-08 Identities = 20/61 (32%), Positives = 36/61 (59%) Query: 19 GLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLI 78 GL+ TL ++V + + + G +L V RLSS + A Y+ +FR+IP ++++ + Y Sbjct: 88 GLLNTLLVSVIGIFLATVMGFILGVGRLSSNWLIRQLATLYIEIFRNIPPLLLIFFVYFA 147 Query: 79 V 79 V Sbjct: 148 V 148 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 224 Length of database: 394 Length adjustment: 26 Effective length of query: 198 Effective length of database: 368 Effective search space: 72864 Effective search space used: 72864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory