Align BztA, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate GFF3104 Psest_3163 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain
Query= TCDB::Q52663 (338 letters) >FitnessBrowser__psRCH2:GFF3104 Length = 342 Score = 382 bits (980), Expect = e-111 Identities = 183/331 (55%), Positives = 234/331 (70%) Query: 8 GSVALAALVAGAASASTLDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAA 67 G+ +L + A + +TLD V+ +G + CG + GL GF+ DA G YQG DV +C+AVAA Sbjct: 12 GAASLLGISGLAQAGATLDAVQKKGFVQCGISDGLPGFSFADAKGKYQGIDVDICRAVAA 71 Query: 68 AVLGDPMKVKYVPLTGETRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGF 127 AV GD KVKY PLT + RFTAL SGEVDVL RN+TWT SRD + L+F V YYDGQGF Sbjct: 72 AVFGDASKVKYSPLTAKERFTALQSGEVDVLSRNTTWTSSRDAAMGLNFTGVTYYDGQGF 131 Query: 128 MVNKSLGVSSAKELDGATICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAG 187 +VNK LGVSSAKELDGAT+C+Q GTTTE+NL+D+F+AN YTP+ E + +G Sbjct: 132 LVNKELGVSSAKELDGATVCIQAGTTTELNLSDYFRANGHKYTPITYDTSDESAKSLESG 191 Query: 188 ACDSYTTDASGLASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALV 247 CD T+D S L + R L AD V+LPE+ISKEPLGP VR GD W DIVRW+ +A++ Sbjct: 192 RCDVLTSDQSQLYAQRIKLAKPADYVVLPEVISKEPLGPAVRQGDEEWFDIVRWTLFAML 251 Query: 248 AAEEYGITKANLEEVAASTQNPEIRRLLGLEGDMGKKIGLDNDFAKRAILASGNYGEVFE 307 AEE G+T AN+EE+A ST+NP++ RLLG EG+ GK + L D+A + + GNYGE+F+ Sbjct: 252 NAEELGVTSANVEEMAKSTKNPDVARLLGAEGEYGKDLKLPKDWAVQIVKQVGNYGEIFD 311 Query: 308 ANIGASTSIGLARGLNAQWTQGGLMYAPPFR 338 N+GA + + + RGLNA W GGL YAPP R Sbjct: 312 RNVGAGSELKIERGLNALWNNGGLQYAPPVR 342 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 342 Length adjustment: 28 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory