Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate GFF3103 Psest_3162 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= TCDB::Q8YPM8 (308 letters) >FitnessBrowser__psRCH2:GFF3103 Length = 394 Score = 157 bits (398), Expect = 3e-43 Identities = 115/305 (37%), Positives = 159/305 (52%), Gaps = 24/305 (7%) Query: 21 LIALFLAAFVVAIL-LGNLNRN-----LQRLGIQFGFDFLKQQASFDIGETLIAYKPTDT 74 +I +FLA + IL +G L+ N L L I+ + F + +I+ P Sbjct: 97 VIGIFLATVMGFILGVGRLSSNWLIRQLATLYIEIFRNIPPLLLIFFVYFAVISPLPGPR 156 Query: 75 YSLALW-VGLINSLRI---------AFVGIILTTIVGILAGIARLSDNWLVRNISLVYVE 124 SL+LW V +N+ + F L +V ++A + R+ + Sbjct: 157 NSLSLWDVVFVNNRGVQMPAPSAGDGFWAFWLALLVALVAVVVLNRWARARRHATGRMFP 216 Query: 125 IFRNTPLLLQLLFWYFAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGL 184 +F +P L + W G P L F + W PE ++++ L Sbjct: 217 VFWTSPGLFLAIPWLMTFIAGAPFTWEVPELQRF------NIRGGWVVI-PELVSIVVAL 269 Query: 185 IFYTGAFIAEIVRGGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLN 244 YT AFI E VR GIQSVS GQ EA SLGL P ++RLVI PQALRVI+PPLTSQYLN Sbjct: 270 SVYTAAFIGETVRSGIQSVSHGQTEAAASLGLRPGQVLRLVIVPQALRVIVPPLTSQYLN 329 Query: 245 LTKNSSLAIAIGYPD-IYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIMNAFNRTV 303 L KNSSLA AIGYPD + A T NQTG+A+E M + M YL++S++ISL+MN +N+ + Sbjct: 330 LAKNSSLAAAIGYPDMVSLFAGTVLNQTGQAIETMAITMSVYLAISISISLLMNWYNKRI 389 Query: 304 QIKER 308 + ER Sbjct: 390 ALIER 394 Score = 127 bits (320), Expect = 3e-34 Identities = 68/177 (38%), Positives = 99/177 (55%), Gaps = 3/177 (1%) Query: 20 QLIALFLAAFVVAILLGNLNRNLQRLGIQFGFDFLKQQASFDIGETLIAYKPTDTYSLAL 79 Q++A+ L N NL GI GF FL A F I + LI Y +DTY Sbjct: 26 QVLAVLAVVAFGWYLFHNTQTNLAHRGITSGFGFLNNAAGFGISQHLIDYSESDTYGRVF 85 Query: 80 WVGLINSLRIAFVGIILTTIVGILAGIARLSDNWLVRNISLVYVEIFRNTPLLLQLLFWY 139 WVGL+N+L ++ +GI L T++G + G+ RLS NWL+R ++ +Y+EIFRN P LL + F Y Sbjct: 86 WVGLLNTLLVSVIGIFLATVMGFILGVGRLSSNWLIRQLATLYIEIFRNIPPLLLIFFVY 145 Query: 140 FAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGLIFYTGAFIAEIV 196 FAV LP N +SL + ++ G+++P + F A L L+ A +A +V Sbjct: 146 FAVISPLPGPRNSLSLWDVVFVNNRGVQMPAPSAGDGFWAFWLALLV---ALVAVVV 199 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 308 Length of database: 394 Length adjustment: 29 Effective length of query: 279 Effective length of database: 365 Effective search space: 101835 Effective search space used: 101835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory