Align ABC transporter for D-Cellobiose and D-Salicin, periplasmic substrate-binding protein (characterized)
to candidate GFF1857 Psest_1896 ABC-type sugar transport system, periplasmic component
Query= reanno::Smeli:SMc04259 (411 letters) >FitnessBrowser__psRCH2:GFF1857 Length = 415 Score = 258 bits (659), Expect = 2e-73 Identities = 152/413 (36%), Positives = 221/413 (53%), Gaps = 11/413 (2%) Query: 5 FLAAALGATAALPFGAASATDLEVTHWWTSGGEAAAVAELAKAFDATGNKWVDGAIAGSG 64 F AL + ALP A A ++EV HWWTSGGE A L K + G+ W D A+AG G Sbjct: 4 FHRLALSVSLALPV-LAHAGEVEVLHWWTSGGEKRAADTLQKLVEQKGHSWKDFAVAGGG 62 Query: 65 G-TARPIMISRITGGDPMAATQFNHGRQAEELVQAGLMRDLTDIATKENWKEIVKPSSLL 123 G A ++ +R G+P +A Q G +E + GL+ +L D A E W ++ P + Sbjct: 63 GEAAMTVLKTRAVSGNPPSAAQIK-GPDIQEWGELGLLANLDDTAKAERWDALL-PEQVR 120 Query: 124 DSCTIEGKIYCAPVNIHSWQWLWLSNAAFKQAGVEVPKNWDEFVAAAPALEKAGIVPLAV 183 +G PVN+H WLW++ F++AG + PK DEF AAA L+ AG +P+A Sbjct: 121 KIMQYDGSYVAVPVNVHRVNWLWINPEVFEKAGAKPPKTLDEFFAAADKLKAAGFIPVAH 180 Query: 184 GGQPWQANGAFDVLMVAIAGKENFEKVFAQKDEEVAAGPEIAKVFKAADDARR-MSKGTN 242 GGQPWQ F+ +++I G +++ K F + D + G ++ + F A R + Sbjct: 181 GGQPWQDGTVFEGFVLSILGPDDYHKAFVELDNDTLTGDKMVQAFTALKKLRDYIDADAA 240 Query: 243 VQDWNQATNMVITGKAGGQIMGDWAQGEFQLAGQKAGVDYTCLPGLGVNEVISTGGDAFY 302 ++WN+AT MVI GKAG QIMGDWA+ EF A + AG +Y CLP G + D+ Sbjct: 241 GREWNRATGMVIDGKAGMQIMGDWAKSEFTAANKVAGKNYQCLPFPGTQGSFAFNIDSLA 300 Query: 303 FPLLEDEEKSKAQEVLASTLLKPETQVAFNLKKGSLPVRGDVDLAAANDCMKKGLDIL-- 360 L ++ KAQE LA T+L+PE Q FN KGS+PVR D D++ + C ++ + Sbjct: 301 MFKLSSDDNRKAQEDLARTVLEPEFQTFFNQNKGSIPVRQDQDMSEFDACAQQSMTDFKE 360 Query: 361 -AKGNVIQGT---DQLLSADSQKQKEDLFSEFFANHSMTPEDAQKRFADIIAA 409 AKG+ +Q + S+ Q D+ + FF + P+ A K+ A I A Sbjct: 361 AAKGSGLQPSLTHGMAASSYVQGAVFDVVTNFFNDPKADPQKAAKQLAAAIKA 413 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 415 Length adjustment: 31 Effective length of query: 380 Effective length of database: 384 Effective search space: 145920 Effective search space used: 145920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory