Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate GFF92 Psest_0092 phosphonate C-P lyase system protein PhnK
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__psRCH2:GFF92 Length = 270 Score = 142 bits (358), Expect = 1e-38 Identities = 85/237 (35%), Positives = 137/237 (57%), Gaps = 2/237 (0%) Query: 64 KAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPP-GKIISGKVIFNGMDIFSMT 122 K VSF + GE+LGI+GESGSGK+TL+S + P G + + +D+++ + Sbjct: 32 KGCQGVSFDLYPGEVLGIVGESGSGKSTLLSLLCGRCPPDRGSVQYRDAAGDWLDLYAAS 91 Query: 123 IDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELLKLVG 182 E R LL + +V Q ++ L + ++ G ++ + L+ V Sbjct: 92 EAERRTLLRTEWGFVEQNPRDGLRMGVSAGANIGERLMAQGVRHYGQLRAAGLDWLQQVE 151 Query: 183 LDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLIKNIN 242 +DPAR+ + P SGGM+QR+ IA +L+ +PKL+ MDEPT LD+ Q LL L++ + Sbjct: 152 IDPARIDDL-PRTFSGGMQQRLQIARNLVSSPKLVFMDEPTGGLDVSVQARLLDLLRGLV 210 Query: 243 QEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSSI 299 +E+ + +V VTHD+ +A+RL+VM + V+E G T++I+ P +PYT LLVSS+ Sbjct: 211 RELDLAVVIVTHDLAVARLLADRLMVMRRSRVVEAGLTDQILDDPQHPYTQLLVSSV 267 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 270 Length adjustment: 27 Effective length of query: 335 Effective length of database: 243 Effective search space: 81405 Effective search space used: 81405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory