Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate GFF3163 Psest_3223 Lactate dehydrogenase and related dehydrogenases
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__psRCH2:GFF3163 Length = 319 Score = 158 bits (400), Expect = 1e-43 Identities = 106/291 (36%), Positives = 151/291 (51%), Gaps = 11/291 (3%) Query: 22 AQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADL 81 +++V + + D V L+ A I + V +T L LK + + G + D+ Sbjct: 28 SELVCHEQSTTDQIVERLQGAQVAIVNKVSLTAETLAACPELKLILVSATGVNNIDLQAA 87 Query: 82 TRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFG---VD 138 RGIV++N T + A L+LA A R+ + V G WQ S L V+ Sbjct: 88 RERGIVVSNCQAYGTPTVAQHTLMLLLALATRLPDYQAAVARGRWQESGQFCLLDFPIVE 147 Query: 139 VQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATAD 198 ++GKTLG++G G +G AVAR A F M+VL N P+ E R++L ELL D Sbjct: 148 LEGKTLGLLGHGELGSAVARLAE-AFGMRVLVGNLPGRPKRPE-----RLDLDELLPQVD 201 Query: 199 FVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDV 258 + L PLT +T++LIGA EL+ MK +A LINA+RG VDE+AL +AL+ G + GA DV Sbjct: 202 ALTLHCPLTEQTRNLIGARELQLMKPTAFLINAARGGLVDEQALADALRRGHLGGAATDV 261 Query: 259 FETEPLPSDSPLL--KLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 +EP D+PLL L ++ PH + E R + AEN A G Sbjct: 262 LTSEPPRDDNPLLAPDLPRLIITPHSAWGSREARQRIVAQLAENATAFFAG 312 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 319 Length adjustment: 28 Effective length of query: 293 Effective length of database: 291 Effective search space: 85263 Effective search space used: 85263 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory