Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate GFF857 Psest_0871 ABC-type sugar transport systems, ATPase components
Query= TCDB::P96483 (377 letters) >FitnessBrowser__psRCH2:GFF857 Length = 371 Score = 303 bits (777), Expect = 4e-87 Identities = 176/375 (46%), Positives = 230/375 (61%), Gaps = 30/375 (8%) Query: 1 MATVTFDKATRIYPGSDKPAVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGG 60 MA+VT + Y G+ P +D+ IEDGEF+V VGPSGCGKST LR++AGLED+ G Sbjct: 1 MASVTLRDICKSYDGT--PITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSG 58 Query: 61 AIRIGDRDVTHLPPKDRDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAA 120 + I ++ V LPPKDR + MVFQ+YALYPHMTVA+NM F LK+A V K EI+++VE A Sbjct: 59 DLLIDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVA 118 Query: 121 KILDLTQYLDRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAS 180 +IL L + L+RKPK LSGGQRQRVA+GR +VREP+VFL DEPLSNLDA LRV R +IA Sbjct: 119 EILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIAR 178 Query: 181 LQRRLGITTVYVTHDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPA 240 L +R+ T +YVTHDQVEAMT+ D++ VL G + QV P ++Y P N FVAGF+GSP Sbjct: 179 LHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQ 238 Query: 241 MNLVEVPITDGGVKFGN--------SVVPVNREALSAADKGDRTVTVGVRPEHFDVVELG 292 MN VEV + +PV+ A+S D +T+G+RPEHF Sbjct: 239 MNFVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGD----PLTLGIRPEHF------ 288 Query: 293 GAVAASLSKDSADAPAGLAVSVNVVEELGADGYVYGTAEVGGEVKDLVVRVNGRQVPEKG 352 + D AD + V E LG +Y T E +V + + V+G +G Sbjct: 289 ------VMPDEADFT--FHGQITVAERLGQYNLLYLTLERLQDV--ITLCVDGNLRVTEG 338 Query: 353 STLHVVPRPGETHVF 367 T + + H+F Sbjct: 339 ETFAAGLKADKCHLF 353 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 371 Length adjustment: 30 Effective length of query: 347 Effective length of database: 341 Effective search space: 118327 Effective search space used: 118327 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory