Align N-succinylglutamate 5-semialdehyde dehydrogenase; Succinylglutamic semialdehyde dehydrogenase; SGSD; EC 1.2.1.71 (characterized)
to candidate GFF3587 Psest_3654 succinate-semialdehyde dehydrogenase
Query= SwissProt::Q8ZPV0 (492 letters) >FitnessBrowser__psRCH2:GFF3587 Length = 488 Score = 202 bits (513), Expect = 3e-56 Identities = 154/477 (32%), Positives = 233/477 (48%), Gaps = 33/477 (6%) Query: 2 TLWINGDWITGQ-GERRRKTNPVSAEILWQGNDANAAQVAEACQAARAAFPRWARQPFAA 60 T ++NG+W G R NP + E++ + + A +AA+AA P W Sbjct: 14 TAYLNGEWCEADSGARTEIFNPATGELIGAVPNMGRGETRRAIEAAQAAQPAWRALTAKE 73 Query: 61 RQAIVEKFAALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGAQ- 119 R A + ++ L+ ++ +L ++ E GKP EA EV A S + A G + Sbjct: 74 RAARLRRWYELMLENQEDLARIMTAEQGKPLAEARGEVA-----YAASFLEWFAEEGKRL 128 Query: 120 -----KSELVDGAATLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTLIFKPSELTP 174 + D ++ P GV A P+NFP + PAL AG ++ KP+ TP Sbjct: 129 YGDVIPAHAGDKRILVQKEPVGVTAAITPWNFPSAMITRKAGPALAAGCAMVLKPAPQTP 188 Query: 175 WTGETVIKLWERAGLPAGVLNLVQG----GRETGQALSSLDDLDGLLFTGSASTGYQLHR 230 ++ + L ERAG+PAG+L+++ RE G L + L FTGS + G +L + Sbjct: 189 FSALALAALAERAGIPAGLLSVITADAATSREVGAELCENPIVRKLSFTGSTAVGIKLMQ 248 Query: 231 QLSGQPEKILALEMGGNNPLIIEDAANIDAAVHLTLQSAFITAGQRCTCARRLLVKQGAQ 290 Q + +K L+LE+GGN P I+ D A++DAAV + S + AGQ C CA R+ V+ G Sbjct: 249 QCAPTLKK-LSLELGGNAPFIVFDDADLDAAVEGAMISKYRNAGQTCVCANRIYVQDGIY 307 Query: 291 GDAFLARLVDVAGRLQPGRWDDD---PQPFIGGLISAQAAQHVMEAWRQREALGGRTLLA 347 DAF+ +L RL+ G ++ P I A+ +H+ +A + G TLLA Sbjct: 308 -DAFVDKLSAAVARLKVGNGAEEGVTTGPLIDAAAVAKVQRHLQDALDK-----GATLLA 361 Query: 348 PRKVKE-GTSLLTPGII-ELTGVADVPDEEVFGPLLNVWRYAHFDEAIRLANNTRFGLSC 405 K G + P ++ +T V EE FGPL ++R+ DE IR AN+T FGL+ Sbjct: 362 GGKPHALGGNFFEPTLVGGVTSEMAVAREETFGPLAPLFRFRDEDEVIRQANDTEFGLAA 421 Query: 406 GLVSTDRAQFEQLLLEARAGIVNWNKPLTGAAST--APFGGVGASGNHRPSAWYAAD 460 + D ++ ++ G+V N TG ST APFGG+ ASG R + Y D Sbjct: 422 YFYARDLSRVFRVAEALEYGMVGIN---TGVISTEVAPFGGMKASGLGREGSKYGLD 475 Lambda K H 0.319 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 539 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 488 Length adjustment: 34 Effective length of query: 458 Effective length of database: 454 Effective search space: 207932 Effective search space used: 207932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory