Align Carbon-nitrogen hydrolase family protein; EC 3.5.-.- (characterized, see rationale)
to candidate GFF4217 Psest_4290 N-carbamoylputrescine amidase
Query= uniprot:Q5NHL7_FRATT (286 letters) >FitnessBrowser__psRCH2:GFF4217 Length = 293 Score = 323 bits (828), Expect = 3e-93 Identities = 150/279 (53%), Positives = 197/279 (70%) Query: 4 IKVAVVQLSFNDNEAENLAKLESKIIQAAKNGAKIILTPELPSYLYFCKKQNSKYFDLAK 63 + VA Q++ + + N+A + + +AA GA+IIL EL YFC+K N++Y LA Sbjct: 5 VTVAATQMACSWDRQANIANADKLVREAAAKGAQIILIQELFETPYFCQKPNAEYLQLAT 64 Query: 64 TIDESPIVKLYKLLAHKYNIVLPASFFERDGNACYNSIAMIDADGSIMGVYRKAHIPDGI 123 ++E+P ++ ++ +A + +VLP SFFE G A +NSIA+IDADG ++GVYRK+HIPDG Sbjct: 65 PVEENPAIQHFQKVAAELQVVLPISFFELAGRARFNSIAIIDADGKLLGVYRKSHIPDGP 124 Query: 124 GYQEKYYFSPGSAGFKVWDTKYAKVGVGICWDQWFPEAARVMALKGAEILLYPTAIGSEP 183 GY EKYYF+PG GFKVW+T+YAK+GV ICWDQWFPE AR MAL GAE+L YPTAIGSEP Sbjct: 125 GYHEKYYFNPGDTGFKVWNTRYAKIGVAICWDQWFPETARSMALMGAELLFYPTAIGSEP 184 Query: 184 HLPDYDSKDHWQRVMQGHAAANMLPVLASNRYATEANDDITATYYGSSFITDHTGDKIAE 243 H P+ S+DHWQRV QGHA AN++P++ASNR E D T+YGSSFI D G K+ E Sbjct: 185 HDPNITSRDHWQRVQQGHAGANLMPLIASNRIGREEQDGYDITFYGSSFIADQFGAKVEE 244 Query: 244 ADRSGDDILYATFDFAELQQQRFYWGLFRDRRPELYDEI 282 D + + +L FD +L+ R WG+FRDRRP LY I Sbjct: 245 MDETSEGVLVHQFDLDQLEHIRSAWGVFRDRRPNLYGSI 283 Lambda K H 0.320 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 293 Length adjustment: 26 Effective length of query: 260 Effective length of database: 267 Effective search space: 69420 Effective search space used: 69420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory