Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate GFF2309 Psest_2357 Short-chain dehydrogenases of various substrate specificities
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__psRCH2:GFF2309 Length = 262 Score = 112 bits (281), Expect = 6e-30 Identities = 84/252 (33%), Positives = 125/252 (49%), Gaps = 12/252 (4%) Query: 12 GLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAI----DEATSRFPKLHAGIADVS 67 G V ++ A GIG +A++F A A + + D + A+ DE P L D+ Sbjct: 9 GRCVVITGAAGGIGRGLAQSFAAAGATLELLDRDADALARLADELAGDAP-LRCTALDLG 67 Query: 68 KQAQVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVE---ELDPAQWESTVSTNLNSQFYF 124 + V + DD + DVLVNNAG+ T E E D W + + N+ S Sbjct: 68 DRQAVQRYADDLACRGLHADVLVNNAGVEYATPLDECSFEADQC-WSTLLENNVGSMQRL 126 Query: 125 LRKAVPVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRV 184 R +P L+ AS+I +S+ G G P + Y ++K A+VGL +SLA ELGP +RV Sbjct: 127 TRALLPRLRAG---ASVINQASIWGLKGVPGFSAYVASKHAVVGLTRSLAWELGPRRIRV 183 Query: 185 NAILPGVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASP 244 NA+ PG + + R + ADA G +A L ++ ++T D+ LFL SP Sbjct: 184 NAVCPGWIATDAAMRSLQVMADANGRSDSAELATILSNQAIPELLTPADLGGTFLFLGSP 243 Query: 245 AGSNVTGQAISV 256 + +TGQA+SV Sbjct: 244 LAAALTGQALSV 255 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 262 Length adjustment: 25 Effective length of query: 238 Effective length of database: 237 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory