Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate GFF1178 Psest_1211 xanthine dehydrogenase, small subunit
Query= metacyc::MONOMER-20832 (151 letters) >FitnessBrowser__psRCH2:GFF1178 Length = 482 Score = 72.0 bits (175), Expect = 1e-17 Identities = 46/141 (32%), Positives = 72/141 (51%), Gaps = 12/141 (8%) Query: 15 DADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNV--------VRSCVTPVAGVVG 66 D +T +L +R+ G TGTK GC CGAC+V+V V + SC+T V+ + G Sbjct: 17 DPNTTVLQYLREHRGKTGTKEGCASGDCGACTVVVGELVDDRLRYRTLNSCLTFVSALHG 76 Query: 67 REITTIEAIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSK----AQI 122 +++ ++E ++ V V+ +QCG+C G VM+ AL K+ A ++ Sbjct: 77 KQLISVEDLKDQGRLHSVQQAMVDCHGSQCGFCTPGFVMSLFALQKNAGAVNEYDPHQTH 136 Query: 123 DAAMINLCRCGTYNAIHAAVD 143 +A NLCRC Y I A + Sbjct: 137 EALAGNLCRCTGYRPILEAAE 157 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 151 Length of database: 482 Length adjustment: 25 Effective length of query: 126 Effective length of database: 457 Effective search space: 57582 Effective search space used: 57582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory