GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PfGW456L13_1894 in Pseudomonas stutzeri RCH2

Align ABC transporter for D-Galactose and D-Glucose, periplasmic substrate-binding component (characterized)
to candidate GFF1857 Psest_1896 ABC-type sugar transport system, periplasmic component

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1894
         (432 letters)



>lcl|FitnessBrowser__psRCH2:GFF1857 Psest_1896 ABC-type sugar
           transport system, periplasmic component
          Length = 415

 Score =  513 bits (1322), Expect = e-150
 Identities = 264/432 (61%), Positives = 316/432 (73%), Gaps = 17/432 (3%)

Query: 1   MNAISRLATVISLASLSALPLSVLAAESKGSVEVVHWWTSGGEKAAVDVLKAQVEKDGFT 60
           MNA  RLA  +SLA      L VLA    G VEV+HWWTSGGEK A D L+  VE+ G +
Sbjct: 1   MNAFHRLALSVSLA------LPVLA--HAGEVEVLHWWTSGGEKRAADTLQKLVEQKGHS 52

Query: 61  WKDGAVAGGGGSTAMTVLKSRAVAGNPPGVAQIKGPDIQEWGSTGLLSTDALKDVSKAEN 120
           WKD AVAGGGG  AMTVLK+RAV+GNPP  AQIKGPDIQEWG  GLL+   L D +KAE 
Sbjct: 53  WKDFAVAGGGGEAAMTVLKTRAVSGNPPSAAQIKGPDIQEWGELGLLAN--LDDTAKAER 110

Query: 121 WDGLLSKKVSDTVKYEGDYVAVPVNIHRVNWLWINPEVFKKAGIEKAPTTLEEFYAAGDK 180
           WD LL ++V   ++Y+G YVAVPVN+HRVNWLWINPEVF+KAG  K P TL+EF+AA DK
Sbjct: 111 WDALLPEQVRKIMQYDGSYVAVPVNVHRVNWLWINPEVFEKAGA-KPPKTLDEFFAAADK 169

Query: 181 LKAAGFIALAHGGQPWQDSTVFEDVVLSVMGADGYKKALVDLDQKTLSGPEMTKSFAELK 240
           LKAAGFI +AHGGQPWQD TVFE  VLS++G D Y KA V+LD  TL+G +M ++F  LK
Sbjct: 170 LKAAGFIPVAHGGQPWQDGTVFEGFVLSILGPDDYHKAFVELDNDTLTGDKMVQAFTALK 229

Query: 241 KITGYMDPNRAGRDWNIAAADVISGKAGMQMMGDWAKSEWTAAKKIAGKDYQCVAFPGTE 300
           K+  Y+D + AGR+WN A   VI GKAGMQ+MGDWAKSE+TAA K+AGK+YQC+ FPGT+
Sbjct: 230 KLRDYIDADAAGREWNRATGMVIDGKAGMQIMGDWAKSEFTAANKVAGKNYQCLPFPGTQ 289

Query: 301 KAFTYNIDSMAVFKLKADRKGDIAAQQDLAKVALGTDFQKVFSMNKGSIPVRNDMLNEMD 360
            +F +NIDS+A+FKL +D   +  AQ+DLA+  L  +FQ  F+ NKGSIPVR D     D
Sbjct: 290 GSFAFNIDSLAMFKLSSD--DNRKAQEDLARTVLEPEFQTFFNQNKGSIPVRQD----QD 343

Query: 361 KLGFDECAQKSAKDFIADDKTGGLQPSMAHNMATSLAVQGAIFDVVTNFMNDKDADPAKA 420
              FD CAQ+S  DF    K  GLQPS+ H MA S  VQGA+FDVVTNF ND  ADP KA
Sbjct: 344 MSEFDACAQQSMTDFKEAAKGSGLQPSLTHGMAASSYVQGAVFDVVTNFFNDPKADPQKA 403

Query: 421 SAQLASAVKAAQ 432
           + QLA+A+KA Q
Sbjct: 404 AKQLAAAIKAVQ 415


Lambda     K      H
   0.314    0.129    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 583
Number of extensions: 26
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 432
Length of database: 415
Length adjustment: 32
Effective length of query: 400
Effective length of database: 383
Effective search space:   153200
Effective search space used:   153200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory