Align galactaro-1,5-lactonase (characterized)
to candidate GFF363 Psest_0364 Gluconolactonase
Query= reanno::WCS417:GFF3393 (291 letters) >FitnessBrowser__psRCH2:GFF363 Length = 296 Score = 403 bits (1035), Expect = e-117 Identities = 203/293 (69%), Positives = 224/293 (76%), Gaps = 6/293 (2%) Query: 3 AELIVDARNAVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIARTD 62 AELIVD A GE PVWV E ALYWVDIP L RW+AA G ++ W +MLACIAR Sbjct: 5 AELIVDLGCATGESPVWVAAEQALYWVDIPNRELLRWNAADGQISRWQGDEMLACIARHG 64 Query: 63 AGNWVAGMETGFFQLTPHNDGSLDTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVLNM 122 G WVAGME+GFF L DG LD+ LLA ++H MR+NDGRCDR+GRFWAGSM L+M Sbjct: 65 DG-WVAGMESGFFSLQTRPDGRLDSHLLATIDHQLPAMRMNDGRCDREGRFWAGSMALDM 123 Query: 123 GLNAAEGTLYRYTSGA--APHA-QLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFDY 179 G LYR S + AP QLDGFI NGLAFSPDGRTMY SDSHP VQ+IWAFDY Sbjct: 124 AAGHPVGALYRLDSKSIDAPLVPQLDGFIVPNGLAFSPDGRTMYLSDSHPSVQKIWAFDY 183 Query: 180 DIDTGTPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTVP 239 DID+GTPS RR+FVDM H GRPDGAAVDADGCYWIC NDAG IHRF+PDGRLDRSL VP Sbjct: 184 DIDSGTPSRRRLFVDMLDHPGRPDGAAVDADGCYWICGNDAGFIHRFTPDGRLDRSLAVP 243 Query: 240 VKKPTMCAFGGSRLDTLFVTSIR--DDQSEQSLSGGVFALNPGVVGLPEPTFT 290 VKKP+MCAFGG+RLDTLFVTSIR D S+Q L+GGVFALNPGV GL EP F+ Sbjct: 244 VKKPSMCAFGGARLDTLFVTSIRPGGDLSDQPLAGGVFALNPGVTGLEEPAFS 296 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 296 Length adjustment: 26 Effective length of query: 265 Effective length of database: 270 Effective search space: 71550 Effective search space used: 71550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory