Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate GFF2019 Psest_2062 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >FitnessBrowser__psRCH2:GFF2019 Length = 254 Score = 132 bits (333), Expect = 6e-36 Identities = 88/258 (34%), Positives = 131/258 (50%), Gaps = 16/258 (6%) Query: 14 PKGERLKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEKVEKVAAHWREQGADVV 73 P + ++ KV L+TGAA GIG AI + A++V DI VE++A +V Sbjct: 7 PVIQEVEGKVALVTGAASGIGRAIALLLHERGAKVVAEDIN-PAVEELAR------PGLV 59 Query: 74 AIKADVSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQMTEEDWHRCFAIDLDGA 133 ++AD++ +A+E GR+D+LVN AG+ + + + MT +DW R A++ A Sbjct: 60 PLRADITEDGAAERAVGMAVERFGRLDILVNNAGIIINKLVVDMTRQDWDRIQAVNATAA 119 Query: 134 WYGCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGI 193 + C+ + M+ +G+I+NIAS S P Y +K L LTR L +E GI Sbjct: 120 FLHCREAVKVMMPNRLGAIVNIASYASYFAFPTIAAYTASKGALAQLTRTLALEAIEHGI 179 Query: 194 RVNAIAPGYIETQL---NVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASD 250 RVNAI G + T + V+ GF H + P R QP E+A FLAS+ Sbjct: 180 RVNAIGVGDVVTNILNDVVEDGPGFLTQHGQAA------PIGRAAQPEEIAEIVAFLASE 233 Query: 251 EAPFINASCITIDGGRSV 268 A F+ S + DGG +V Sbjct: 234 RASFMVGSVVMADGGMTV 251 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 254 Length adjustment: 25 Effective length of query: 247 Effective length of database: 229 Effective search space: 56563 Effective search space used: 56563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory