Align ABC transporter for D-glucosamine, permease component 2 (characterized)
to candidate GFF136 Psest_0136 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= reanno::pseudo3_N2E3:AO353_21720 (220 letters) >FitnessBrowser__psRCH2:GFF136 Length = 229 Score = 102 bits (253), Expect = 8e-27 Identities = 58/195 (29%), Positives = 111/195 (56%), Gaps = 9/195 (4%) Query: 21 GFLTSVQCSVLAIMLGTLIGIVAGLVLTYGTLWMRAPFRFYVDLIRGTPVFVLVLACFY- 79 G ++Q ++++ G ++ + G+ + L +RA Y+ RGTP+ V + +Y Sbjct: 16 GAWLTLQLVGVSVIAGLIVAVPLGIARSSRHLAVRALPYGYIFFFRGTPLLVQLFLVYYG 75 Query: 80 ------MAPALGWQI--DAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEASKAIGLT 131 + + W D + ++ +TL +++AEI+RGA+Q +P G++EA++A+G++ Sbjct: 76 MAQFDVVRQSALWPYLRDPYWCAIITMTLHTAAYIAEIIRGAIQNVPHGEIEAARALGMS 135 Query: 132 FYQALAYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIARTFMTLEF 191 QAL +++LP+A R LP + N ++KAS L S I + EL ++I ART++ E Sbjct: 136 RSQALLHIILPRATRIGLPAYSNEVILMLKASALASTITLLELTGMARKIAARTYLHEEM 195 Query: 192 YLFAGFLFFIINYAI 206 +L AG ++ +I + + Sbjct: 196 FLTAGLIYLLIAFIL 210 Lambda K H 0.330 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 229 Length adjustment: 22 Effective length of query: 198 Effective length of database: 207 Effective search space: 40986 Effective search space used: 40986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory