Align NgcF, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate GFF1858 Psest_1897 ABC-type sugar transport systems, permease components
Query= TCDB::Q8RJU9 (308 letters) >FitnessBrowser__psRCH2:GFF1858 Length = 305 Score = 126 bits (317), Expect = 6e-34 Identities = 84/280 (30%), Positives = 138/280 (49%), Gaps = 23/280 (8%) Query: 13 LAVPLGLYALLVVWPFIQSIYYSFTDWTGLSPDFKTVGFDNYERMLDDDIFWKSLQHSLL 72 L V +G YA + W F+ SFT+ + P +K VG YER+ D+D +W + Q+ L+ Sbjct: 33 LIVLVGFYAY-IGWTFL----LSFTN-SRFMPSYKWVGLQQYERLWDNDRWWVASQNLLV 86 Query: 73 FALLLPVVTIGLALFFAFMINVGGRRRRGGPVITGVRGSGFYKIVYFFPQVLSIAIVALL 132 F L V++ + + A +++ +R G + +Y +P LS+ + Sbjct: 87 FGGLFIAVSLIIGVVLAVLLD------------QRIRREGLIRTIYLYPMALSMIVTGTA 134 Query: 133 FAFAYNPDSGAINSLLRGIGLGDVQPVWLGDPDLALWCVMAVIVWSTVGFFVVLFSAGMA 192 + + NP G ++ LLR G + WL DPD ++C++ VW GF + LF AG+ Sbjct: 135 WQWLLNPGLG-LDKLLRDWGWEGFRFDWLVDPDRVIYCLVIAAVWQASGFVMALFLAGLR 193 Query: 193 SIPADIYEAALLDGANRVTTFFRITLPLLWDTVQSGWVYMGILALGAESFAVVHIMTTGP 252 S+ I AA +DGA+ T + RI LP L S + + +A+ +SF +V MT Sbjct: 194 SVDQSIIRAAQVDGASLPTIYLRIVLPSLRPVFFSALMILAHIAI--KSFDLVAAMTA-- 249 Query: 253 GGPDYSTTVMVLYVYQKAFRDGQAAYATTIGVALLIVTLA 292 GGP YS+ + +++Y F GQ + +L +A Sbjct: 250 GGPGYSSDLPAMFMYAHTFTRGQMGLGAASAMLMLGAVMA 289 Lambda K H 0.330 0.145 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 305 Length adjustment: 27 Effective length of query: 281 Effective length of database: 278 Effective search space: 78118 Effective search space used: 78118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory