Align uronate dehydrogenase (EC 1.1.1.203) (characterized)
to candidate GFF3507 Psest_3572 Nucleoside-diphosphate-sugar epimerases
Query= BRENDA::Q888H1 (275 letters) >FitnessBrowser__psRCH2:GFF3507 Length = 307 Score = 84.7 bits (208), Expect = 2e-21 Identities = 57/174 (32%), Positives = 90/174 (51%), Gaps = 6/174 (3%) Query: 14 LLLTGAAGGLGKVLRETLRPYSHILRLSDIAEMAPAVGDHEEVQ--VCDLADKDAVHRLV 71 +L+TG AG +G L + L + +R+ D ++V+ V D+AD D V R V Sbjct: 6 ILVTGGAGFIGSNLVDALLARGYAVRVLDNLSTGKRENLPQDVELIVGDVADADCVRRAV 65 Query: 72 EGVDAILHFGGV-SVERPFEEILG---ANICGVFHIYEAARRHGVKRVIFASSNHVIGFY 127 +G A++H V SV+ ++ +G +N+ G ++ EA R GVKRV+FASS V G Sbjct: 66 QGCRAVVHLAAVASVQASVDDPIGTHQSNLVGTLNLCEAMREAGVKRVLFASSAAVYGNN 125 Query: 128 KQNETIDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFPEPQN 181 + + ID +P+ P + Y K E FY ++G+E V R + F Q+ Sbjct: 126 GEGQAIDEDTPKAPLTPYAADKLASEHYLDFYRRQHGLEPVVFRFFNIFGPRQD 179 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 307 Length adjustment: 26 Effective length of query: 249 Effective length of database: 281 Effective search space: 69969 Effective search space used: 69969 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory