GapMind for catabolism of small carbon sources

 

Aligments for a candidate for braE in Pseudomonas stutzeri RCH2

Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF1277 Psest_1310 ABC-type branched-chain amino acid transport system, permease component

Query= uniprot:Q1MCU1
         (463 letters)



>lcl|FitnessBrowser__psRCH2:GFF1277 Psest_1310 ABC-type
           branched-chain amino acid transport system, permease
           component
          Length = 418

 Score =  356 bits (913), Expect = e-103
 Identities = 199/339 (58%), Positives = 239/339 (70%), Gaps = 19/339 (5%)

Query: 116 LLYPMVVVAIKGP-QGSLTYVDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGA 174
           ++  +V+VA+  P  GS   VD     ILIYVML  GLNIVVGLAGLLDLGYV FYAVGA
Sbjct: 94  IILALVLVALVWPFYGSRGAVD-IATLILIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGA 152

Query: 175 YSYALLSSYFGLSFWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLI 234
           Y+YALLS Y+G+ FW  LP++G  AAL+G +LGFPVLRLRGDYLAIVTL FGEIIR++L 
Sbjct: 153 YTYALLSHYYGVGFWTALPIAGAMAALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLR 212

Query: 235 NWTDVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYK----IFLFYLILAL 290
           N T VT G  GIS I K TLFG+ FD  A    + FH     AY      IFL+ + L L
Sbjct: 213 NMTSVTGGPNGISGIDKPTLFGLSFDRRAAEGMQTFHEYFGVAYNSVNKVIFLYLIALLL 272

Query: 291 CMLTAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFA 350
            +LT +V  RL RMPIGRAWEALREDEIACR+LG+N    KL+AF  GA FAGFAGSFFA
Sbjct: 273 VLLTLFVINRLLRMPIGRAWEALREDEIACRALGMNPTVIKLSAFTLGATFAGFAGSFFA 332

Query: 351 ARQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGP 410
           ARQG VSPESF F+ESA+ILAIVVLGGMGS  G+ +AAIVM+   EL+RE S        
Sbjct: 333 ARQGLVSPESFTFIESAIILAIVVLGGMGSQLGVILAAIVMILLPELMREFS-------- 384

Query: 411 DFTPELYRMLIFGLAMVVVMLFKPRGFVGSREPTAFLRE 449
                 YRML+FG  MV++M+++P+G +  + P   L++
Sbjct: 385 -----EYRMLMFGALMVLMMIWRPQGLLPMQRPHLELKQ 418


Lambda     K      H
   0.330    0.145    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 640
Number of extensions: 37
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 463
Length of database: 418
Length adjustment: 32
Effective length of query: 431
Effective length of database: 386
Effective search space:   166366
Effective search space used:   166366
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory