Align GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate GFF4197 Psest_4270 TRAP transporter, DctM subunit
Query= TCDB::P74224 (445 letters) >FitnessBrowser__psRCH2:GFF4197 Length = 426 Score = 197 bits (501), Expect = 5e-55 Identities = 132/433 (30%), Positives = 232/433 (53%), Gaps = 16/433 (3%) Query: 11 MFVGALVFLGCGYPVAFSLGGVAILFAIIGAALGSFDPIFLSAMPQRIFGIMANGTLLAI 70 +F V + G PVA SLG L +I F + ++ ++F + TLLAI Sbjct: 6 LFAALFVLMFIGVPVAVSLGLAGSLTIMI------FSQDSVRSLAIKLFETSEHYTLLAI 59 Query: 71 PFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTGVVAATVVAMG 130 PFF+ G+ + G+A +L++ +GH+RGGLA+ +L + AA +G ATV A+G Sbjct: 60 PFFLLAGAFMTTGGVARRLIDFANACVGHIRGGLAIGAVLACMLFAALSGSSPATVAAVG 119 Query: 131 LISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLGVSVGDLFIGSLLPGL 190 I++ M+R GY + +G++ +GTLG +IPPSVV++V A SVG LF+ ++PG+ Sbjct: 120 SIAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSVVMVVYAAATETSVGKLFMAGVVPGI 179 Query: 191 MMAGSFALYVLIIAWLKPDLAPALPAEVRNIGGQELRRRIVQVMLPPLVLILLVLGSIFF 250 ++ G+ + + IIA +K +L PALP R+ I L+L++++LG I+ Sbjct: 180 LLGGALMIAIYIIA-VKKNL-PALPRASFREWLSAARKAIW-----GLLLMVIILGGIYS 232 Query: 251 GIASPTEAGAVGSIGAIALAHFNQR-LNWKALWEVCDATLRITSMVMLILLGSTAFSLVF 309 G+ +PTEA AV ++ + +A F + ++ + +V + +++ M+M I+ + F+ V Sbjct: 233 GMFTPTEAAAVAAVYSAFVALFVYKDISLRDCPKVLLESGKLSIMLMFIIANAMLFAHVL 292 Query: 310 RGLEGDRFMFDLLANLPGGQIGFLAISMITIFILGFFIDFFEIAFIVLPLFKPVAEALNL 369 + + + + FL + I + I G F++ I I+ P+ P+A L + Sbjct: 293 TTEQIPQAITAWVIEAGLQPWMFLLVVNIVLLIAGAFMEPSAIILILAPILFPIAIQLGI 352 Query: 370 DLIWYGVIVGANLQTSFLTPPFGFALFYLRGVAPASLTTGQIYRGAVPFIGLQVLVLLLI 429 D I G+I+ N++ +TPP G LF V +T Q+ R +P++ L + L++I Sbjct: 353 DPIHLGIIMVVNMEIGLITPPVGLNLFVASAVTGMPVT--QVIRAVLPWLALMLSFLVII 410 Query: 430 IIFPALINWLPSL 442 P++ LP++ Sbjct: 411 TYVPSISLALPNM 423 Lambda K H 0.331 0.148 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 426 Length adjustment: 32 Effective length of query: 413 Effective length of database: 394 Effective search space: 162722 Effective search space used: 162722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory