GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mcl in Pseudomonas stutzeri RCH2

Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate GFF2614 Psest_2665 Citrate lyase beta subunit

Query= BRENDA::Q9I562
         (275 letters)



>lcl|FitnessBrowser__psRCH2:GFF2614 Psest_2665 Citrate lyase beta
           subunit
          Length = 275

 Score =  374 bits (961), Expect = e-109
 Identities = 198/273 (72%), Positives = 221/273 (80%), Gaps = 1/273 (0%)

Query: 1   MNRQIVRSALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDTPE 60
           MN  I+RSALFVPATRPERIPKALASGAD VIVDLEDAV E LK EAR NL  FL   P+
Sbjct: 1   MNSSIIRSALFVPATRPERIPKALASGADAVIVDLEDAVAENLKAEARGNLDAFLAANPD 60

Query: 61  ARVLVRINAAEHPGHADDLALCRDHAGVIGLLLPKVESAAQVRHAAVASGKPVWPIVESA 120
           AR+LVRINA  H   A DLALC  HAGV+G+LLPKVESA QV  AA + GKPVWPIVESA
Sbjct: 61  ARLLVRINAPTHAEQAADLALCARHAGVVGVLLPKVESAVQVALAA-SCGKPVWPIVESA 119

Query: 121 RGLAALGEIAAAAGVERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAGLAP 180
           RGLA L EIA A GVERLSFG+LDL LDL L +G+  AE++L  ARYALLLQ+RLAGLA 
Sbjct: 120 RGLANLAEIAHAQGVERLSFGALDLGLDLGLANGTAGAERMLDQARYALLLQSRLAGLAA 179

Query: 181 PLDGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARRVAE 240
           PLD V+P I+N  GL  A   ARDMGFGGLLCIHPSQV  +H+TLMPS AEL+WA+R+  
Sbjct: 180 PLDSVFPDIKNLDGLTRAAADARDMGFGGLLCIHPSQVAVVHETLMPSAAELDWAQRILA 239

Query: 241 AGASGAGVFVVDGEMVDAPVLGRARRLLERAGE 273
           AGASG GVFVVDG+MVDAPV+GRARRLL+RAG+
Sbjct: 240 AGASGDGVFVVDGQMVDAPVIGRARRLLQRAGQ 272


Lambda     K      H
   0.320    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 270
Number of extensions: 10
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 275
Length of database: 275
Length adjustment: 25
Effective length of query: 250
Effective length of database: 250
Effective search space:    62500
Effective search space used:    62500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory