Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate GFF3713 Psest_3782 Alcohol dehydrogenase, class IV
Query= BRENDA::A4IP64 (395 letters) >FitnessBrowser__psRCH2:GFF3713 Length = 388 Score = 232 bits (591), Expect = 2e-65 Identities = 141/367 (38%), Positives = 209/367 (56%), Gaps = 7/367 (1%) Query: 5 RIVFPPLSHVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHV 64 RIV P L VG GA QL +K LG L++TD M+V++G V ++ L + G + Sbjct: 4 RIVLPRLMEVGAGASQQLARVLKELGCNRPLIVTDRMMVELGYVARIAGQLGEAGIASQC 63 Query: 65 YTDVVPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLT 124 + D +PEP + V R G FD ++ +GGGS +D AK +L G + DY Sbjct: 64 FADTLPEPTAASIRAGVEMVRQGDFDSIVALGGGSPIDSAKAIGILGKFGGEMRDY---R 120 Query: 125 GTRTLEKKGLPKILIPTTSGTGSEVTNISVLSLETTKDVVTHDYL--LADVAIVDPQLTV 182 R + + GLP I IPTT+GTGSE T ++++ ET+ + + L + A++D +LT+ Sbjct: 121 FPRDVSEAGLPLIAIPTTAGTGSEATRFTIITDETSDEKMLCAGLGFMPIAALIDYELTL 180 Query: 183 SVPPRVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQARI 242 S+PPRVTA TGIDALTHA+EAYVS AS SD A+ A+RL++ +LR A ++ AR Sbjct: 181 SLPPRVTADTGIDALTHAIEAYVSRKASLYSDAQALEAMRLLAPNLRAAFHEPGNRAARE 240 Query: 243 DMANGSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTKRMA 302 M G+ LAG+AF NA VA VH ++ P+G FH+ HG SNA+LLP + + + +R A Sbjct: 241 AMMLGATLAGIAFSNASVALVHGMSRPIGAFFHVPHGLSNAMLLPAITAFSIPAAPERYA 300 Query: 303 DIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAVQQK 362 D A+G + S A+ + + EL ++ +P FGI L ++ + ++ Sbjct: 301 DCARAMGVAAQTDSVGVANDKLLAELRAINQELQVPSP-EQFGISRERFFEL-RETMARQ 358 Query: 363 RLLARSP 369 L + SP Sbjct: 359 ALASGSP 365 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 388 Length adjustment: 31 Effective length of query: 364 Effective length of database: 357 Effective search space: 129948 Effective search space used: 129948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory